KEGG   Rattus norvegicus (rat): 362728Help
Entry
362728            CDS       T01003                                 

Gene name
Twistnb
Definition
(RefSeq) TWIST neighbor
  KO
K03004  DNA-directed RNA polymerase I subunit RPA43
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    362728 (Twistnb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    362728 (Twistnb)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     362728 (Twistnb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SHS2_Rpb7-N RPA43_OB Med19
Motif
Other DBs
NCBI-GeneID: 362728
NCBI-ProteinID: NP_001102177
RGD: 1307824
Ensembl: ENSRNOG00000010750
UniProt: D4ADH7
Position
6q16
AA seq 321 aa AA seqDB search
MAAGSVESQRPKAASERPVAGQAGILPCLELPSYAAACALVSSRYSCLVAAPHRRHIALS
PRYLSRKRTGIREQLDAELLRYSESLLGVPIAYDNIRVVGELGDIYDDQGHIHLNIEADF
VIFCPKPGQKLMGTVNKVSSSHIGCLVHGCFNASIPKPEQMSYEEWQTLEINVGDELEFD
VFRLDSDSAGVFCIRGKLNTTSLQHKGSVVSEDVEETVIEEVVEKIPKKKKKKDKDREVC
ATVESVTEVADVTDAAAEDEAGLPCSDDVNDFFEEEPKKKKKKKKRHQEDQDPIFQASDS
SGYQSDHKKKKKKRKHSEEAN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgggctctgtggagtcgcagcggcccaaggcggcctccgagaggccggtggcg
ggtcaggccgggattctgccttgcctggaactaccgagctatgccgcggcgtgtgcgctg
gtaagcagccgctattcctgcttggtggccgccccgcaccgcaggcacatcgccttgtcg
ccccgctacctgagcaggaagcgcacgggcatccgcgagcagctggacgccgaactcctg
cgctactccgagagccttttaggtgttcccattgcatatgataacatcagagttgtgggt
gaactgggagatatttatgatgatcaaggacacattcatcttaacattgaagccgatttt
gttattttctgccctaaaccagggcagaaactgatgggtacagttaataaagtgtcttct
agccatattggctgtttagtacatggatgttttaatgcttctatccctaaacctgagcag
atgtcatatgaggagtggcaaacattggagataaatgtaggggatgaactggaatttgat
gtgtttcgcttagactcagattctgctggagtattctgcattcgaggaaaactaaatacc
acaagtttgcagcataagggctctgtagtttctgaagatgtagaagaaactgtcattgaa
gaggttgttgaaaaaattccaaagaagaagaagaagaaagacaaagacagagaagtctgt
gcaacagtggaaagtgttacagaggtagcagatgttacagatgctgctgcagaggacgaa
gcaggcctgccgtgtagtgatgatgtcaatgacttctttgaggaagagccaaagaagaag
aaaaagaagaagaaaaggcaccaggaagatcaggaccccattttccaagccagtgactcc
agtggctaccaaagtgaccataaaaagaaaaagaagaaaagaaaacacagtgaagaggct
aactga

DBGET integrated database retrieval system