KEGG   Rattus norvegicus (rat): 362736
Entry
362736            CDS       T01003                                 

Gene name
Hectd1, RGD1561653
Definition
(RefSeq) HECT domain E3 ubiquitin protein ligase 1
  KO
K12231  E3 ubiquitin-protein ligase HECTD1 [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362736 (Hectd1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     362736 (Hectd1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   362736 (Hectd1)
SSDB
Motif
Pfam: HECT BTHB Sad1_UNC MIB_HERC2 Ank_2 Ank_5 Ank_4 Ank Ank_3 F5_F8_type_C
Other DBs
NCBI-GeneID: 362736
NCBI-ProteinID: XP_006240148
RGD: 1561653
Ensembl: ENSRNOG00000006905
UniProt: D3ZLS5
Position
6q23
AA seq 2610 aa
MADVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKI
FLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVELNNRTSRDLA
EQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHLVHKDTLHSAMAVVSRLCGKMEPQ
DSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSRM
AAAGGTVSGPSSACKPGRSTTGAPSAAADSKLSNQVSTIVSLLSTLCRGSPLVTHDLLRS
ELPDSIESALQGDERCVLDTMRLVDLLLVLLFEGRKALPKSSAGSTGRIPGLRRLDSSGE
RSHRQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGA
DVNRGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARERGHSEVVAILQ
SPGDWMCPVNKGDDKKKKDTNKDEEECNEPKGDPEMAPVYLKRLLPVFAQTFQHTMLPSI
RKASLALIRKMIHFCSEALLKEVCDSDAGHNLPTALVEITATVLDQEDDDDGHLLALQII
RDLVDKGGDIFLDQLARLGVISKVSALAGPSSDDENEEESKPEKEDEPQEDAKELQQGKP
YHWRDWSVIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEGGSDSSES
RSEFLEKLQRARGQVKPSTSSQPILSAPGPTKLTVGNWSLTCLKEGEIAIHNSDGQQATI
LKEDLPGFVFESNRGTKHSFTAETSLGSEFVTGWTGKRGRKLKSKLEKTKQKVRTMARDL
YDDHFKAVESMPRGVVVTLRNIATQLESSWELHTNRQCIEGENTWRDLMKTALENLIVLL
KDESTISPYEMCSSGLVQALLTVLNSSIDLDMKQDCSQLVERINVFKTAFSESEDDESRP
AVALIRKLIAVLESIERLPLHLYDTPGSTYNLQILTRRLRFRLERAPGETALIDRTGRML
KMEPLATVESLEQYLLKMVAKQWYDFDRSSFVFVRKLREGQNFIFRHQHDFDENGIIYWI
GTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDKNAWFAID
LGVWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL
DPAKDEKQGWRHVRLKQMGKNASGQTHYLSLSGFELYGTVNGVCEDQLGKAAKEAEANLR
RQRRLVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSN
SYRMGAEGKFDLKLAPGYDPDTVASPKPVSSTVSGTTQSWSSLVKNNCPDKTSAAAGSSS
RKGSSSSVCSVASSSDISLGSTKTERRSEIVMEHSIVSGADVHEPIVVLSSAENVPQTEV
GSSSSASTSTLTAETGSENAERKLGPDSSVRAPGESSAISMGIVSVSSPDVSSVSELTNK
EAASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPNLSSRETSSLESFVRRVANIARTNA
TNNMNLSRSSSDNNTNTLGRNVMSTATSPLMGAQSFPNLTTPGTTSTVTMSTSSVTSSSN
VATATTVLSVGQSLSNTLTTSLTSTSSESDTGQEAEYSLYDFLDSCRASTLLAELDDDED
LPEPDEEDDENEDDNQEDQEYEEVMILRRPSLQRRAGSRSDVTHHAVTSQLPQVPSGAGS
RPIGEQEEEEYETKGGRRRTWDDDYVLKRQFSALVPAFDPRPGRTNVQQTTDLEIPPPGT
PHSELLEEVECTPSPRLALTLKVTGLGTTREVELPLSNFRSTIFYYVQKLLQLSCNGNVK
SDKLRRIWEPTYTIMYREMKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDLITYLQKN
ADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTRSGLNQGASSSLQSSDILNLT
KEQPQAKAGNGQNPCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDEFTSKK
ITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQN
RREATVERTRTTSSVRRDDPGEFRVGRLKHERVKVPRGESLMEWAENVMQIHADRKSVLE
VEFLGEEGTGLGPTLEFYALVAAEFQRTDLGTWLCDDNFPDDESRHVDLGGGLKPPGYYV
QRSCGLFTAPFPQDSDELERITKLFHFLGIFLAKCIQDNRLVDLPISKPFFKLMCMGDIK
SNMSKLIYESRGDRDLHCTESQSEASTEEGHDSLSVGSFEEDSKSEFILDPPKPKPPAWF
NGILTWEDFELVNPHRARFLKEIKDLAIKRRQILGNKSLSEDEKNTKLQELVLKNPSGSG
PPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQK
QMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGF
LRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCV
HYLKLPEYSSEEIMRERLLAATMEKGFHLN
NT seq 7833 nt   +upstreamnt  +downstreamnt
atggcagatgtggatcctgatacgttgctggagtggctgcagatgggacagggagatgaa
agggacatgcagctaatagccctggaacagctatgcatgttgcttttgatgtctgacaat
gtggatcggtgttttgaaacatgtccacctcgtactttcctaccagctctctgcaaaatt
tttcttgatgaaagtgctccagacaatgtcttagaggtgacagctcgtgccataacgtac
tacctggatgtgtctgcagagtgcacccgaaggattgtaggggtggatggggctataaaa
gcactctgtaatcgcttggtggtggttgaactcaacaacagaaccagcagagacttagct
gaacagtgtgtaaaggtgctggaactgatatgcactcgtgagtcaggagcagtctttgag
gctggtggtttgaattgtgttctcaccttcattcgtgacagcggacacctagttcataaa
gatacattacactctgcgatggcggtggtatcgagactctgtggtaaaatggaacctcag
gattcttctctagaaatttgtgtagagtctctatctagtttattgaaacatgaagatcat
caggtttcagacggagctctgaggtgttttgcatcactagccgaccgatttactcgtcga
ggagtggacccagctccattggccaagcacggcttaactgaggagctgttatctcgaatg
gcagctgctggtggcactgtatcaggaccgtcttcagcatgcaaaccgggtcgcagtacc
acaggagccccctctgcagctgcagattccaaattgagtaaccaggtgtcaacaattgta
agtcttctctccacactttgcagaggctctccactagtaacacacgatcttctgaggtca
gagcttccagattcaattgaaagtgcattacagggtgatgaaagatgtgtgcttgatacc
atgcgtctggttgacctcctcttggtgctgttatttgaaggacgaaaggctttgcctaag
tctagtgctggatctacaggcagaatcccaggactacggagactggatagttctggggaa
cgctcccatcggcagcttatagactgtattcgaagtaaagatactgatgctctcatagat
gcaattgacacaggagcctttgaagtaaattttatggatgatgtgggtcagactctatta
aattgggcctctgcgtttggaactcaggaaatggtagaatttctgtgtgagaggggcgct
gacgttaatagaggccaaaggtcctcatcgttacactatgctgcatgttttggaagacct
caagtagcaaagactctgttacggcatggtgcaaatccggatctcagagatgaagatggg
aaaacaccattggataaagctcgagaaagaggccacagtgaagtagtagcaattctccag
tcgccaggtgattggatgtgtccagttaataaaggggatgataaaaaaaagaaagataca
aacaaagatgaagaagagtgtaatgagcccaaaggagacccggaaatggcaccagtatac
ttgaagaggctgttgcctgtgtttgcacaaacatttcagcacactatgttgccttcaata
aggaaagccagtcttgctttaattcgaaaaatgattcacttttgctctgaagcactgtta
aaagaagtctgtgattctgacgctggtcacaatttgcccacagcactagtggaaatcact
gcgactgtccttgaccaagaggatgatgatgatggccacttactagctttgcagatcata
agggacttagtagataaaggtggtgatatttttttggatcagctcgccagacttggtgta
attagcaaagtgtcagctttggcaggtccttcttctgatgatgagaatgaagaggaatca
aaaccagaaaaggaagacgaaccacaggaagacgctaaagaattgcagcaaggcaagccg
taccattggagagactggtcagtaatcagaggacgggactgcttatatatctggagtgat
gctgcagctttggagttgtctaatggcagtaatggatggttcagatttatcttggatgga
aaacttgccaccatgtattcaagtggtagtcctgaaggtggatcggatagttcagaaagc
agaagtgaattcttagagaagttacaaagagcccgtggccaagtaaagccatctacttca
agtcaacctatcctgtcagcaccggggcccactaaacttaccgtagggaactggtcatta
acatgtttgaaagaaggagaaattgctattcataactcagatggtcagcaagctacaata
ctaaaggaagatttgcctggctttgtatttgaatctaatagaggaactaagcattcgttt
actgcagaaacatctctgggttcagagtttgtgactggctggactggcaaaagaggcagg
aaattaaaatccaaattggaaaaaacaaagcaaaaggtacgaactatggcccgagatttg
tatgatgaccactttaaagctgtggaaagcatgcctcgtggagtggtggtaacactcaga
aatatagcaactcagttggagtcatcttgggaacttcatacgaatagacaatgcatcgaa
ggtgaaaacacatggcgagacttaatgaagacagcattagaaaacctgattgtgcttctg
aaggatgagagcacgatctccccatatgagatgtgcagcagtggcttagtccaagccctg
ctcactgtattgaacagtagtatagatttggatatgaagcaagattgcagtcaactggta
gaaagaataaatgtcttcaaaacagccttcagtgaaagtgaagatgatgaaagtagacca
gcagttgcattaattcgaaagttaatagctgtactagaatcaattgagcgactacctctc
catttgtatgatacaccaggatccacatataacctccagatactgacaagaagattacgc
tttcggttggaacgtgcacctggtgaaactgcattaatagaccggacaggcaggatgctg
aagatggagcccttagctacagttgaatctctggaacagtatctgctgaaaatggtagca
aagcagtggtacgattttgaccggtcctcatttgtttttgttcgaaaattgagagaaggc
caaaattttatatttcggcaccagcatgattttgatgaaaatggaatcatttactggatt
ggaacaaatgcaaaaactgcatatgaatgggtaaatcctgcagcttatggtcttgtagtc
gtgacatcatcagaaggaagaaatctaccatatggccgcttggaagacatactaagtcga
gataattcagctttaaattgtcatagcaatgatgataaaaatgcctggtttgccatagat
ctgggtgtctgggtaataccatcagcatacacacttcgtcatgctcgtggctatggaagg
tctgcactgagaaactgggttttccaggtatccaaagatggacagaactggacttctttg
tatacccatgttgatgactgcagtctcaatgaaccagggtcaactgcaacgtggccactt
gacccagcaaaggatgaaaaacaaggatggcggcatgtgaggctgaagcagatgggaaag
aacgcaagcggacagacacactacctctccctctctggctttgagctctatggcactgta
aatggcgtgtgtgaagaccaactcgggaaagcagctaaagaagcagaagctaatcttaga
aggcagaggcgcctggtgcgttctcaagtcctgaagtacatggttccaggagcacgtgtt
atcagaggccttgactggaagtggcgagatcaggatggcagcccacagggagaaggcaca
gtcacaggagagctgcacaatggctggattgatgtcacctgggatgctggtggctcaaac
tcttaccgtatgggcgcagaaggaaaatttgacctcaagcttgcaccagggtacgaccct
gatacagtggcatcacccaaacctgtttcatccactgtttcaggcacaacgcagtcatgg
agcagcttggtgaaaaacaactgtccagacaagacgtctgctgctgcaggctcctcaagt
agaaaaggaagcagcagttctgtgtgtagcgtggccagtagcagcgacatcagcttgggt
tcgaccaaaacggaacggagatcagaaattgtaatggaacacagtatagtttcaggagct
gatgtccatgaaccaattgttgttctttcatctgctgaaaacgttcctcaaacagaagta
gggtcatcttccagtgcaagcaccagcaccctaacagcggaaacgggaagtgaaaatgct
gaaaggaagttaggcccggatagttctgttcgagctcctggggagtctagtgcaatatcc
atgggaattgttagcgttagctctcctgatgttagttcagtatctgaattaactaataag
gaagcagcttcacaacgaccccttagctcgtcagcaagtaacagactgtcagtgagctct
ctgttggcagctggggcccctatgagctctagtgcaagtgtacctaacctgtcctcaaga
gaaacatctagcttggagagctttgtaaggagagtggcaaacatagcacggactaatgcc
accaacaacatgaacctgagccggagcagcagtgataacaacactaacactctggggcgg
aatgtgatgagcaccgcaacttctcctcttatgggtgctcagagtttccctaatttgacc
acacctggtactacatcgacagtgacaatgtcaacatcaagtgttactagcagcagcaat
gtagctacggcgacaacagttttatcagtgggtcagtcattaagtaatactttaaccacc
agcctcacatcaacctctagtgagagtgacacagggcaggaagcagaatattccttatat
gactttcttgatagctgtcgtgccagtactctcttagctgagctagatgatgacgaggac
ttgcctgaaccggatgaggaagacgatgagaacgaagatgacaatcaggaggaccaagaa
tacgaggaggttatgattctgagacgtccatctttgcaacgtcgtgctggctctcgctct
gatgtaacacaccatgctgtcacctcacagctaccacaggtcccttctggagcagggagc
cgacctattggggaacaggaagaagaagagtatgaaactaaaggaggccgccggagaacc
tgggatgacgactacgtgctgaagcggcagttctctgcactggttcccgcttttgatcct
aggcctggtcgtaccaatgtccaacagacaactgacctagaaatccctcccccaggaaca
cctcactcagagctcttggaggaagtcgagtgtactccatcacctcgattggctctcacg
ttgaaagtgactgggcttggaacgactcgggaagttgaactgccacttagcaacttcaga
tcaaccatcttttattatgtacagaaactgcttcagctgtcttgtaatggcaatgtgaag
tcagacaaacttaggcgtatttgggagccaacttacacaatcatgtatagagaaatgaag
gattctgataaagaaaaggaaaatgggaaaatgggttgctggtctatagagcatgtggaa
cagtaccttggcactgatgaattaccaaagaatgacttgataacctacctgcagaagaat
gctgacgccgctttccttcgccactggaaattaactggcactaataaaagtattaggaaa
aacagaaattgttctcagcttatagccgcatataaggatttttgtgagcatggaacaagg
tctggattaaaccagggggctagttctagtcttcaaagcagtgatattcttaatttgaca
aaagagcagcctcaggctaaagccggcaacggacagaacccctgtggagtagaggacgtt
cttcagcttctgcgcattctgtatatagttgcaagtgacccttattcaaggatatcccaa
gaagatggtgatgagcagccccagtttacttttccacctgatgaatttactagtaaaaag
atcaccacaaaaattttgcagcagattgaggagccattggctttggcaagcggggctctg
ccagactggtgtgaacagctgaccagcaagtgtcctttcctaatcccattcgaaaccaga
cagctttacttcacctgtactgcgtttggtgcatccagagcaatagtgtggctacagaat
cgacgggaagccacagtggagcgaacaaggaccacgagcagtgtaaggcgagatgatcct
ggggaatttagagttggccgactcaagcacgaaagagtgaaggttccccgtggagagtct
ctgatggagtgggctgagaatgtcatgcaaatacacgcagaccggaagtcagttctcgag
gttgaatttctaggagaagaaggaactggcctgggacccactttagagttttatgctctt
gtggcagcagaattccagaggaccgacttggggacttggctttgtgatgataactttcca
gatgatgaatctcgtcatgttgaccttggaggtgggttgaagcctcctggatactatgta
cagcgatcatgtggactgttcacagcgccatttccacaagacagtgatgagctggaaagg
atcacaaaactcttccatttccttgggattttcttggccaaatgtattcaagacaataga
ttggtggacttgcctatttctaagcctttctttaaacttatgtgcatgggcgacattaaa
agcaatatgagcaaactgatctatgaatcacgaggcgacagagacttgcactgcactgaa
agtcagtctgaagcgtctacggaagaaggtcatgactccctctcagtaggaagctttgaa
gaggattcaaaatcagaatttatccttgatccccctaagcccaaacccccggcttggttt
aatggaattttaacttgggaagattttgaactagtaaatccacacagagccagattttta
aaagaaattaaagaccttgctattaagaggcgccagattttaggcaataaaagcctttcc
gaagatgagaagaacacaaagttacaggaactagtactcaagaacccatcaggttctgga
cctccacttagcatagaggacttaggcttaaatttccagttttgcccatcttccagaata
tatggcttcacagcggtggacctcaagccaagtggagaagatgagatgataacaatggat
aatgcagaagaatatgtggatttgatgtttgacttttgtatgcatacgggtatccagaaa
cagatggaagcttttcgagatgggtttaataaagtttttccaatggagaaattaagttcc
ttcagccatgaggaagtccagatgattctttgtggaaatcaatcaccatcctgggcagca
gaggacattatcaattatactgaacctaagcttggctatacacgtgacagtcccggcttc
cttaggtttgtgagggtcttatgtggcatgtcctcagacgaacggaaagcattcctgcag
tttaccaccggctgttcaactctgcccccaggtggactggctaacctgcatccgaggctc
acagtcgtgcgaaaggttgatgctactgatgcaagctatccatccgtcaacacttgtgtc
cactatcttaagttacctgaatattcttctgaggagatcatgagagagcgcttgctagct
gctacaatggagaaaggctttcatctcaactga

DBGET integrated database retrieval system