KEGG   Rattus norvegicus (rat): 362843Help
Entry
362843            CDS       T01003                                 

Gene name
Ilvbl
Definition
(RefSeq) ilvB acetolactate synthase like
  KO
K11259  acetolactate synthase-like protein [EC:2.2.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    362843 (Ilvbl)
Enzymes [BR:rno01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.-  
     362843 (Ilvbl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M CO_dh
Motif
Other DBs
NCBI-GeneID: 362843
NCBI-ProteinID: NP_001102208
RGD: 1307988
Ensembl: ENSRNOG00000028512
UniProt: D4ACG2
Position
7q11
AA seq 672 aa AA seqDB search
MGAWPCDSMMLARGGLSAEVESCVEEGGFPVGSLINRFFLMETTAAAASAGGFFPSFLLL
AFGTLVAAVLGAAHRLGLFYQLMHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISP
LLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQ
SPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVRRVRDIVPTLRAAMAAAQSGT
PGPVFVELPLDVLYPYFMVEKEMIPAQLPKGLMGRVVVWYLQNCLANLFAGAWEPRPEGP
LPLDIPQASPQQVQRCVEILSRAKRPLLVLGSQALLPPTPANKLRAAVETLGVPCFLGGM
SRGLLGRNHPLHIRQNRSAALKKADVVVLAGAVCDFRLSYGRVLNRKSSIIIVNRNRDDM
LLNSDIFWKPQEAVQGDVGSFMIKLVEGLQGQTWSSDWVEELRKADQQKEQTYRDKALLP
VPQHLNPVRLLQQVEETLPDNALLVVDGGDFVATAAYLVQPRGPLRWLDPGAFGTLGVGA
GFALGAKLCQPEAEVWCLFGDGAFGYSLIEFDTFVRHKVPVIALVGNDAGWTQISREQVP
RLGSDVACSLAYTDYHKAAMGLGAQGLILSRDNEDQVVKVLRDGQKLCQEGHAVVVNILI
GRTDFRDGSISV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgtggccttgcgactcaatgatgttagcgcggggcgggctctctgctgaggtc
gagtcctgtgttgaggagggtgggttccccgtgggttccctaataaataggttcttcctc
atggaaactactgcggccgctgcatctgccgggggcttcttcccctcgttcctgctcctg
gcgtttgggacactggtggctgccgtgctgggcgccgctcacagactggggctcttctat
cagctgatgcacaaggtggacaagacaagcatccggcatggcggagagagtgtggcagct
gtgctccgagcccacggcgtacgctttgtcttcacgttggtcggtgggcacatttcccca
ctgctggtggcctgtgagaagctgggcatccgagtggtagacacacgccatgaggtcact
gctgtctttgctgctgatgctgtggcccgcttgactgggacagtgggcgtggcagcagtg
acagccggtcctggcctcaccaacaccgtgactgcagtgaagaatgcccaagtggcacag
tccccagtcctgcttctgggtggggctgccagcaccctgctgcagaaacggggcgcgctc
caggccattgatcagatgtctctgttcaggccactctgcaaattctgtgcgtctgtgcga
agggtacgggacattgtacctaccctgagggctgcaatggctgccgcccaatcgggcacc
ccaggcccggtgtttgtggagctgcctcttgatgtgctgtatccctacttcatggttgag
aaggagatgataccagcccagctgcccaagggcctcatgggtcgagtggttgtctggtac
ttacagaactgcctggccaacctctttgctggggcttgggagcctcgtcccgagggacct
ctgcccttggacattccccaggcgtctccccagcaggtccaacgctgtgtggagatcctg
agccgggccaagaggcctctgctggtgctggggagccaggccctgctacccccaaccccc
gccaacaagcttagggctgctgtggagaccctgggtgtcccctgcttcctcggggggatg
tctcggggcctgctgggccgcaaccaccctctccacatccggcagaaccgcagcgctgcc
ctgaagaaagcagatgttgttgtcctggcgggtgctgtgtgcgatttccgcctgtcttat
ggtcgcgtcctcaaccgcaagagcagcatcatcattgtcaaccggaaccgggatgatatg
ttgctcaactcagacatcttctggaagccccaggaggctgtgcagggagatgtgggctcc
ttcatgatcaaactggtggaaggcctgcagggccagacgtggtcctcagactgggttgag
gagcttcggaaagccgaccagcagaaggagcagacttaccgggataaggctttgttgcct
gtacctcagcacctgaacccagtacggctgttacagcaggtggaggaaactctgcctgac
aacgcgcttcttgtggttgacggcggggacttcgttgccactgctgcctacttagtacag
cccagagggcccctgcgctggctcgaccctggggcctttgggactctgggagttggcgca
ggttttgcacttggggccaagctgtgtcagcccgaggccgaggtttggtgcctgtttggg
gatggagcctttggctacagcctcattgagttcgacacgttcgtcagacataaggtaccg
gtgatagccttggtagggaacgatgcaggttggacccagatttctcgggagcaggtgccc
aggttgggcagtgatgtggcctgtagcctggcttacaccgattatcacaaggcagccatg
ggcctgggggcccagggattgatactctcacgggacaacgaggatcaagtggtcaaggta
cttcgtgatggccagaagctgtgccaggagggccatgctgtcgtggtcaacatcctgatc
gggaggacagatttcagagatggctccatttctgtatag

DBGET integrated database retrieval system