KEGG   Rattus norvegicus (rat): 363457
Entry
363457            CDS       T01003                                 

Gene name
Col4a5
Definition
(RefSeq) collagen alpha-5(IV) chain isoform X2
  KO
K06237  collagen type IV alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04974  Protein digestion and absorption
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    363457 (Col4a5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    363457 (Col4a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    363457 (Col4a5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    363457 (Col4a5)
  09154 Digestive system
   04974 Protein digestion and absorption
    363457 (Col4a5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    363457 (Col4a5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    363457 (Col4a5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    363457 (Col4a5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    363457 (Col4a5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    363457 (Col4a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    363457 (Col4a5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    363457 (Col4a5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   363457 (Col4a5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   363457 (Col4a5)
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 363457
NCBI-ProteinID: XP_006257374
RGD: 1565499
Ensembl: ENSRNOG00000018951
Position
X
AA seq 1688 aa
MQVPGVCLAAGWFLLALCLWGQPGEAAACHGCSSGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNQGYPGPPG
IQGPPGPKGVSGPSGPPGPPGLMGPPGPPGPPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDLDFQKGDQGVPGDRGPPGPPGIPGPPGPPGGVKGEKGEPGEPGKRGKP
GKDGETGQPGIPGLPGDPGYPGEPGRHGEKGQKGDTGPPGPPGFVIPTPGTGVTIGAKGN
IGQPGLPGEKGERGFPGIQGPPGFPGPPGTAVMGPPGPPGYPGERGQKGDEGPPGICIPG
SPGLDGQPGAPGFPGPPGPPGPQLPPSDEICKAGPPGPPGSPGDQGLQGEQGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGIPGEKGEKGQAGTTGPKGLPGIPGPPGAPGF
PGSKGDPGDVLTLPGMKGEKGELGSPGAPGLPGLPGSPGKDGLPGLPGPKGEPGGITFKG
ERGPPGNPGLPGLPGNMGPTGPVGFGPPGPVGEKGIQGVAGNPGQPGLPGPKGDPGQTIS
QPGKPGLPGNPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGPPGPPGPKGFPGI
PGPPGPPGAPGRMGPEGPPGLPGFPGPKGEPGFGLPGPPGPPGFPGFKGTPGPKGDRGLP
GPPGPPGHTGLDGLPGPKGDAGPNGQPGPIGPPGLPGIGLQGPPGPPGTPGPIGQPGLHG
IPGEKGDPGPPGLDVPGLPGERGSPGLPGAPGLIGPPGSPGIPGRAGVPGFPGVKGEMGM
MGPPGPPGPLGTPGRSGAPGLKGDDGMQGQPGLPGPVGEKGGKGEPGLPGPPGPMRPDFL
GSKGEKGDPGLPGIPGLSGPKGYQGLPGDPGQPGLSGQPGSPGLPGPKGTPGLPGPPGLT
GPPGPKGNIGDMGFPGPQGVDGPPGPPGGPGQPGSPGLPGQKGSKGEPGVSGIGLPGLPG
PKGEPGLPGYPGNPGIKGSMGEAGLPGLPGSPGAKGQPGLPGFPGTPGLPGPKGMNGPPG
NPGLPGEPGPVGGGGRPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGL
SGQKGDGGAPGLPGNPGLPGSKGEPGFQGFPGMPGPPGPPGSPGPSLEGPKGNPGPQGPP
GRPGPPGPPGTEGPRGPPGNGGIKGERGNPGPPGQPGLPGLKGDQGPPGLPGNPGRPGLN
GMKGDPGLPGVPGFPGMKGPIGVPGSTGPDGEPGLTGPPGPPGLPGPSGQSIVIKGDPGP
PGIPGQPGLKGLPGLPGPQGLPGPIGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGSRGL
DGPPGPDGLQGPPGPPGTTSVAHGFLITRHSQTTDAPQCPQGTVHIYDGFSLLYVQGNKR
AHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMNMEPLKGQSI
QPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASP
GSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDMSDMFSKPQSETLKAGDLRTRISR
CQVCMKRT
NT seq 5067 nt   +upstreamnt  +downstreamnt
atgcaagtgcctggagtgtgcctggccgccggctggttcttactggccctgtgtctgtgg
gggcagccgggagaggctgcggcctgccatgggtgttcttctggatcaaaatgtgactgc
agtggtataaaaggagaaaagggagaacggggctttccaggcttagaaggccatccaggt
ttaccaggatttccaggtccagaagggcctccaggacctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaaggaatcagaggtcctcctggacttcctggattt
ccagggacaccaggccttcctgggatgccaggccacgatggggctccaggacctcaaggt
atccctggatgcaatggaaccaagggagaacgcggatttccaggcagtccaggctttccc
ggtttacaaggacctccaggaccacctgggatcccaggtatgaagggggagccaggcagt
ataatcatgtcatctctgccagggccaaagggtaatcaaggatacccaggtcctcctgga
atacaaggtccacctggtcccaagggtgtatcagggccaagtggtcctccaggaccacca
ggtttaatgggccctcctggcccaccaggcccaccgggaccaaaggggaatatgggctta
aatttccagggacccaaaggcgaaaaaggtgaacaaggtcttcagggtccacctggtcca
cctgggcagatcagtgaacagaaaagaccaattgacctagattttcagaaaggcgatcag
ggagttcccggtgatagagggcctcctggacctccgggaatacctggtcctcccggtcct
cctggtggtgtgaaaggtgaaaagggtgagcccggagagccaggcaaaagaggtaaacca
ggcaaagatggagagactggtcaaccaggaatcccaggtttgcctggtgatcctggttac
cctggtgaaccaggaaggcatggtgaaaagggccaaaagggtgatactggcccacctgga
ccacctggatttgtaattcctacacctggaactggtgtgactattggagcaaaaggaaat
attgggcaacctggtttgcctggagaaaaaggagagcgaggatttcctggcatacaaggt
ccacctggctttcctggacctccagggacagctgtcatgggtccccctggtcctcctgga
tatcctggtgaaaggggccagaaaggtgatgaaggtccccctggaatttgtattcctgga
tctcctggacttgatggacagcctggagctcctggctttccaggacctcctggtcctcct
ggcccccagttacccccgagtgatgaaatctgtaaagcaggccctccagggcccccagga
tctccaggtgaccaaggactccaaggagagcaaggagtaaaaggtgacaaaggtgatact
tgcttcaactgtattggaactggcatttcagggcctccaggccaaccaggtttaccaggt
ctcccaggtcctccaggatctcttggaatccctggagagaagggcgagaaaggacaagct
gggacaactggtccaaaaggattgccaggcattcctggacctccaggtgctccaggcttt
ccagggtctaagggtgaccctggtgatgttctcactcttccgggaatgaaaggtgaaaaa
ggagaattgggttcccctggagctccagggcttcctggtctacctggtagtcctggaaag
gatggtttgccaggacttcctggccccaaaggagagcccggtggaatcacttttaagggt
gaaaggggtcctcctgggaacccaggtttaccaggtctcccaggaaatatgggacctaca
ggccctgttggttttgggcctccaggccccgtaggtgaaaaaggcatacaaggtgtggcg
ggaaatccaggccagccaggattaccaggtcctaaaggtgatccaggccagaccatcagc
cagccaggaaagcctggcttgccagggaatccaggcagagatggtgaagtgggtcttcca
ggtgatcctggacttccaggccaaccaggcctaccaggaatacctggtagcaaaggagaa
ccaggtatccctgggattgggcctccaggaccacctggtcccaaaggttttccaggaatt
cctggacctccaggacctcctggggcccctggaagaatgggcccagaagggcctcctggg
ttaccgggctttccaggacccaagggagagccaggatttgggttacctgggccacctggg
ccaccaggattcccaggtttcaaaggaacacctggtccaaaaggtgatcgtggtttacca
ggacctccaggtcctccaggacacactggcttggatgggctacctggaccaaaaggtgat
gctggaccaaatggacaacctggcccaatagggccaccagggctgccaggaattggtctt
cagggaccaccaggaccaccagggactccagggccaataggccaacctggcttacatgga
ataccaggagagaagggagatccaggacctcctgggcttgatgttccaggactccctgga
gagagaggtagtccagggctccctggagcccctggtcttataggacctccaggatcacct
ggtatccctggaagagcaggtgtccctggatttccaggtgtcaaaggcgaaatgggtatg
atgggacctccaggcccaccgggacctttgggtactcctggcaggagtggtgctcctggt
cttaaaggtgatgacggcatgcaaggtcagccaggtctccctggccctgtaggagaaaag
ggtggtaagggagaacctggccttccaggtcctcctggaccaatgcgtccagatttcctg
ggatcaaaaggagaaaagggtgatcctggcttaccaggtattcctggactttccggacca
aaaggctaccagggattacctggagacccagggcaacctgggctgagtggacagccggga
tcaccaggactaccaggtcccaaaggtactcctggtctccctggtccaccaggacttacc
ggacctcctggacctaaaggaaacattggcgacatgggttttcctggccctcaaggtgta
gatgggcctcctggacctcctggaggtcctggacaacctggctctcccgggttgcctggc
cagaaaggaagtaaaggagaacctggagtttcaggcattggtctccctggtcttcctggt
ccaaagggtgaacctggtctgcctggatatccaggaaacccaggtatcaaaggttctatg
ggcgaggctggtctgcctggcttaccaggaagccctggagcaaaaggtcaacccggcctg
cccggattcccaggaacaccagggcttcctggaccaaagggtatgaatggtcctcctggt
aaccctggccttccaggagaacctggtcctgtaggtggtggagggcgtcctggaccacca
ggacctcctggtgaaaaaggcaagccaggtcaagatggcattcctggaccagcaggacaa
aagggagaaccaggtcaaccaggctttggaatcccaggacctcctggactcccaggactt
tctggtcaaaagggtgatggaggagcccctggccttccaggaaatcctggccttccaggt
tcaaagggtgaaccaggctttcagggattccctggtatgccaggtcccccaggtccccct
ggttctcctggcccatctttggaaggtcccaaaggaaaccctgggcctcaaggccctcct
gggagaccaggtcctccaggtccacctggtacagaaggtcctcgtggcccccctggaaat
ggaggtattaaaggagagaggggaaatccaggtccacctgggcaaccaggcttacctggc
ttgaaaggagatcaaggaccaccaggccttccgggtaaccctggccgaccaggtcttaat
ggaatgaaaggagatcctggtctccctggtgttccaggattcccaggaatgaaaggaccc
attggagtaccaggctcaactggccctgatggggaaccaggtcttacggggcccccaggt
cctcctgggttgcctggtccttcaggacagagtattgtaatcaaaggagatcctggacct
ccaggaattcctggacaacctggattaaaaggtctaccaggacttccaggccctcaaggt
ctaccaggtccaattggccctccaggagatccaggacgcaatggactcccaggctttgat
ggtgcaggagggcgcaaaggagacccaggcctgccggggcagccaggtagccgtggattg
gatggtcccccaggaccagatggattgcaaggacctccagggcccccgggaaccacctct
gttgcccatggattcctcatcacacgtcacagtcagacaacagatgcaccacaatgccca
cagggaacagtccatatctatgatggcttttctctcttatatgtacaaggaaataaaaga
gcccatggtcaagacttggggacagctggcagctgccttcgtcgcttcagtaccatgcct
ttcatgttctgcaacattaacaacgtttgtaactttgcttcaagaaatgactattcttac
tggctttccaccccagagcccatgccaatgaacatggaacccctgaagggccagagcatc
cagccattcattagtcgatgtgcagtatgtgaggcaccagctgtggtgattgcagttcac
agccagactattcagattcctcactgtcctcaggggtgggactctctgtggattggctat
tcattcatgatgcatacaagtgcaggagcagaaggctctggccaagccctagcctctcct
ggctcctgtttggaagaatttcgttcagctcccttcatcgaatgtcatggacgagggaca
tgcaattactatgccaattcttacagcttttggctggccactgttgatatgtcagacatg
ttcagtaaacctcagtcagagacactgaaagcaggcgacttgaggacacgtattagccga
tgtcaagtatgcatgaaaaggacataa

DBGET integrated database retrieval system