KEGG   Rattus norvegicus (rat): 363577
Entry
363577            CDS       T01003                                 

Gene name
Itk
Definition
(RefSeq) tyrosine-protein kinase ITK/TSK
  KO
K07363  IL2-inducible T-cell kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04660  T cell receptor signaling pathway
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    363577 (Itk)
   04670 Leukocyte transendothelial migration
    363577 (Itk)
   04062 Chemokine signaling pathway
    363577 (Itk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    363577 (Itk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     363577 (Itk)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  TEC family
   363577 (Itk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 BTK PH SH3_9 SH3_10 SH3_2 PH_8 SH3_3 ABC1 SH3_4 PH_3
Other DBs
NCBI-GeneID: 363577
NCBI-ProteinID: NP_001102295
RGD: 1311618
Ensembl: ENSRNOG00000006860
Position
10
AA seq 626 aa
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQTLTSFQVMHDNYLLYVFAPDCESRQRWVLTLKEETRNNN
SLVSKYHPNFWMDGRWRCCSQLEKLAVGCAPYDPTKNASKKPLPPTPEDNRRSFQEPEET
LVIALYDYQTNDPQELALRRDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSPNSL
ETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENNPCIKHYH
IKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSWRQKAPVTAGLRYG
KWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLS
HPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLE
KACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSR
YSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASPHVYQVMNHC
WKEKPEDRPPFSRLLSQLAEIAECGL
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgaacaacttcatcctcctggaagaacagctgatcaagaagtcccaacagaagagaagg
acttctccctcgaattttaaagtccgtttcttcgtcttaacgaaagccagcctggcatac
ttcgaggaccgccacgggaagaagcgcacgttgaagggctccatcgaactctccagaatc
aagtgcgtggagattgtcaagagtgacattagcatcccgtgccactataaataccctttt
cagactcttacgtccttccaggtcatgcacgacaactacctcctgtacgtgtttgctcca
gactgcgagagccgtcagcgctgggtgctcacccttaaagaagaaacgaggaataacaac
agcctagtatccaagtatcaccctaatttctggatggatgggcggtggaggtgctgttcc
cagctagagaagcttgccgtaggctgtgctccctacgacccaacgaagaatgcttcaaag
aagcctcttcctcctactcctgaagacaacaggcggtcatttcaggaacctgaagaaacc
ctggtcattgccttgtacgactaccaaaccaacgatcctcaggagctcgcgctgcggcgt
gatgaagagtactacctgctggacagctccgagatccactggtggcgggttcaagacaag
aatgggcatgaaggatatgcacccagcagttacctggtggaaaagtctccaaatagcctt
gaaacctacgagtggtacaataaaagcatcagccgagacaaagctgaaaaacttcttttg
gacacaggtaaagaaggagcattcatggtccgagattccaggacacccgggacatacaca
gtctctgtcttcaccaaggccatcataagtgagaacaacccctgtataaaacattatcac
atcaaagaaacaaatgacagccccaagcggtactatgtggctgagaagtatgtgtttgac
tccatccctctcctcatccagtatcaccaatacaatggaggaggtttggtcactcgactc
cggtatccagtttgctcctggaggcagaaagcccctgtcacagcagggctaagatatggg
aagtgggtgatccagccctcggagctaactttcgtgcaggagattggcagcgggcagttt
ggactggtgcatctcggctactggctcaacaaggacaaggtggccatcaagaccattcag
gaaggggcgatgtcagaagaagactttatcgaggaggcagaagtcatgatgaaactctct
caccccaagctggtgcagctctatggggtgtgcttggagcaagcccccatctgcctggtg
tttgagttcatggagcacggctgcctatcggattaccttcgaagtcagcggggtctcttt
gctgcagagaccctgctgggcatgtgcctggacgtgtgtgagggcatggcctacctagaa
aaagcgtgtgtcatccacagagacctggccgccaggaactgtttggtgggagaaaaccag
gtcatcaaggtgtccgacttcggcatgacaaggtttgtccttgatgatcaatataccagc
tccacgggcaccaaattcccagtgaagtgggcatccccagaagtgttctccttcagccgc
tacagcagcaagtcagatgtgtggtcatttggtgtactgatgtgggaagtcttcagcgaa
ggcaaaatcccatatgaaaaccgaagcaattcagaggtcgtggaagacatcagcactggc
tttcggttatacaagccccgcctggcctcccctcatgtctaccaggtcatgaatcactgc
tggaaagagaaaccggaagaccggccacccttctcccggctgttaagccaactggctgaa
atcgcagaatgtggactttag

DBGET integrated database retrieval system