KEGG   Rattus norvegicus (rat): 363984
Entry
363984            CDS       T01003                                 

Gene name
Ikbke
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    363984 (Ikbke)
   04621 NOD-like receptor signaling pathway
    363984 (Ikbke)
   04622 RIG-I-like receptor signaling pathway
    363984 (Ikbke)
   04623 Cytosolic DNA-sensing pathway
    363984 (Ikbke)
   04625 C-type lectin receptor signaling pathway
    363984 (Ikbke)
   04657 IL-17 signaling pathway
    363984 (Ikbke)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    363984 (Ikbke)
   05160 Hepatitis C
    363984 (Ikbke)
   05171 Coronavirus disease - COVID-19
    363984 (Ikbke)
   05164 Influenza A
    363984 (Ikbke)
   05162 Measles
    363984 (Ikbke)
   05168 Herpes simplex virus 1 infection
    363984 (Ikbke)
   05167 Kaposi sarcoma-associated herpesvirus infection
    363984 (Ikbke)
   05169 Epstein-Barr virus infection
    363984 (Ikbke)
   05165 Human papillomavirus infection
    363984 (Ikbke)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    363984 (Ikbke)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    363984 (Ikbke)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     363984 (Ikbke)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   363984 (Ikbke)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like zf-RING_9 DUF2878
Other DBs
NCBI-GeneID: 363984
NCBI-ProteinID: NP_001102324
RGD: 1308352
Ensembl: ENSRNOG00000025100
UniProt: D4A5E7
Position
13
AA seq 717 aa
MQSTTNYLWHTDDLLGQGATANVYKARNKKSGEVVAVKVFNSASYRRPPEVQVREFEVLR
RLDHENIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLEDPENTFGLPEEEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGKEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAISGTQKQENGPLEWSYSLPITCRLSVGLQSQLVPILANILEAEQAKCWGFDQFFA
ETSDILQRTVIHVFSLPQAVLHHIYIHAHNTIAIFLEAVYEQTNVAPKHQEYFFEGHPCV
LEPSLSAQHIAHTAASSPLTLFSMASDTPKGLAFRDPALDVPKFVPKVDLQADYSTAKGV
LGAGYQALWLARVLLDGQALMLRGLHWVLVVLQNTCQQTLEITRTALLFLSSSLGTERLS
SGAGMLDIQELKEATELRSRLQTFSEVLSKCSHNVTETQRSLSCLVGELLKSRDQIHEDN
RSIQKIQCCLDKMHFIYKQFKKSRMRPGLSYNEEQIHKLDKVNFSHLAKRLLQVFQEECA
QTYQVSLVTHGKRMRQVQKAQNHLHLIGHSVATCNSEARGAQESLAKMFDQLLLDRASKQ
GAEVSPQPMATHPGPDPKDLVFHMQELCNDMKLLAFDLQDNNRLIERLHRVPPTPEV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgcagagtaccactaactacctgtggcatactgatgacctgctagggcagggggccact
gccaatgtgtacaaggcccggaataagaaatccggggaggtggttgctgtaaaggtcttc
aactcagccagctaccggcggccccctgaggtacaagtgagggagttcgaggtcttgcgg
aggctggatcatgagaacatcgtgaagctattcgcagtggaggaaacgggaggcagccgg
cagaaggtgctagtgatggagtactgctccagtgggagcctgctgagcgtgctggaagac
cctgagaacacattcggccttcctgaggaggagttcctggtggtactgcgctgtgtggtg
gctggcatgaaccacctgcgggagaatggcattgtccaccgtgacatcaagcccgggaat
atcatgcgcctggtaggcaaggaggggcagagcatctacaagctgtctgacttcggggct
gcccggaagctggacgacgatgagaagtttgtttctgtctatggtacagaggagtacctg
caccctgacatgtatgagcgggcagtgcttcgcaaaccccagcaaaaggcgttcggggtg
acagtggatctctggagtattggggtgaccttgtaccacgcagccaccggtagtctgccc
ttcatcccctttggtgggccccggcgcaacaaggagatcatgtataggatcaccacagag
aagccagctggggccatttccgggactcagaagcaggaaaatggtcccctggaatggagc
tacagcctccccatcacctgtagactgtctgtggggctgcagagtcagctagtgcccatc
ctggccaacatcctggaggccgaacaggctaaatgctggggcttcgatcagttctttgca
gagaccagtgacatcctgcagcgaactgtcatccatgtcttctccctgccccaggcggtt
ttgcatcacatctacatccatgcccacaacacgattgccatctttttggaggctgtatat
gaacagaccaacgtggcccccaaacaccaagaatacttcttcgagggtcacccttgtgtc
ctcgagccaagcctctcagcccagcacatcgcccacacagctgccagcagccctctaact
ctgttcagcatggccagcgacacacccaaggggctggccttcagggaccctgctctggat
gtcccaaagttcgtccctaaggttgacctacaggccgattacagcaccgctaagggcgtg
ctgggcgctggttaccaggccttgtggctggcgcgggtcctgctggatggacaggcgttg
atgcttcgagggttacactgggtcctggtggtgcttcagaacacgtgccaacagacactg
gagatcacacggacagccctcctcttcctcagtagcagcctgggcactgaaaggctcagc
agtggagctgggatgcttgacatccaggaactaaaggaagccacggagctgaggtccagg
ctgcagactttctcagaggtcctgtctaagtgttcccacaatgtcacagaaacccaaagg
agcctgagttgtctggttggagagcttttgaagagccgggatcagattcatgaggataac
agaagtatccagaagattcagtgttgtttggacaagatgcacttcatctacaaacagttc
aagaagtctaggatgaggccaggcctcagctacaatgaggagcagatccacaagctggat
aaggtaaattttagtcacctagccaagaggctgctgcaggtgttccaggaggagtgtgca
cagacgtatcaggtgtcactggtcacacatggcaagcggatgaggcaggtgcagaaggcc
cagaaccacctgcacctcattggccactccgtggctacctgtaactcagaagcccgggga
gcccaggagagcctggccaagatgtttgatcagctcctcctggacagagcttccaaacag
ggagctgaggtctcaccacaacctatggcaactcatcccggccccgatccgaaggacctg
gtcttccacatgcaggaactttgtaatgatatgaagctattggcctttgatctccaggac
aacaacagactcatcgaacggctacatagagttccaccaacaccagaagtctga

DBGET integrated database retrieval system