KEGG   Rattus norvegicus (rat): 364018
Entry
364018            CDS       T01003                                 

Gene name
Ncf2
Definition
(RefSeq) neutrophil cytosolic factor 2
  KO
K08010  neutrophil cytosolic factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04670  Leukocyte transendothelial migration
rno05020  Prion disease
rno05140  Leishmaniasis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    364018 (Ncf2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    364018 (Ncf2)
   04670 Leukocyte transendothelial migration
    364018 (Ncf2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    364018 (Ncf2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    364018 (Ncf2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    364018 (Ncf2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    364018 (Ncf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    364018 (Ncf2)
Membrane trafficking [BR:rno04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    364018 (Ncf2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 TPR_1 PB1 TPR_2 TPR_8 TPR_12 SusD-like_3
Other DBs
NCBI-GeneID: 364018
NCBI-ProteinID: NP_001094454
RGD: 1309424
UniProt: A7E3N2
Position
13q21
AA seq 527 aa
MSLAEAIRLWNEGVQAADKKDWKGALEAFSEVQDPHSRICFNIGCMYTILDNLQEAEQAF
TKSINRDKHLAVAYFQRGMLYYSMEKYRPASVGRKAALLFLGSYNLVARIIVGYPLSPGK
VLYNIALMHAKKEEWKKAEEQLALATNMKSEPRHSKIDKAMESIWKRCPTSHLPLDPPQV
TMALWFEEGGVGKRSVVASVVHQDNFSGFAPLQPQSAEPPPRPKTPEIFRALEGEAHRVL
FGFVPETPEELQVMPGNIVFVLKKGSDNWATVMFNGQKGLVPCNYLEPVELRIHPQSQPQ
EDTSLESDIPPPPNSSPPERLQLSPGWCQQLGPLRCPPFLLHQEVKRSVPMPYMLKVHYK
YTVVMETQLGLPYSQLRNMVSKKLELLPEHTKLSYQRRDSPELLLLSEESMKDAWAQVKN
YCLTLWCEHTVGDQGFVDEPKEKENSDADNRTTEPQPKEGTQVVAIFSYDATQPEDLEFV
EGDVILVLSHVNEEWLEGECKGKIGIFPKAFVEGCAAKNLEGTPREV
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtccctagctgaggccatcaggctctggaatgagggggtgcaggcagccgacaagaag
gactggaagggtgccttggaggccttcagcgaggtgcaggacccccactcgaggatttgc
ttcaacataggctgcatgtacaccatcctggacaacctgcaggaggctgagcaggccttc
accaaaagcatcaacagagacaagcacttggcagtggcttacttccagcgaggaatgctc
tactacagcatggagaagtaccgtccagcttctgtgggtaggaaggctgccttgctcttt
ctgggcagttataacttagtagctagaataattgttggttatcccctcagtcctgggaaa
gtgttgtataacatcgctctcatgcatgccaagaaagaggaatggaaaaaagcagaagag
cagttagcattggcaacaaacatgaagtctgagcccaggcattccaagattgacaaggcc
atggaaagcatctggaagaggtgtcctacctcccatctccctctggatcctccacaagtg
acaatggctctgtggtttgaggaaggaggagtgggcaaacggagcgttgtagcctctgtg
gttcaccaagacaatttttctggcttcgcccctctgcagccacagtcagcagagcctccg
cccagacccaaaaccccagagatcttcagggctctggaaggcgaggcacatcgtgtgttg
tttggctttgtgccggagacgccggaagaactacaggtcatgcccgggaacatcgtcttt
gtcttgaagaagggcagtgataactgggccaccgtcatgttcaacggacagaaggggctt
gtcccttgcaactacctggagcccgttgagcttcgaattcaccctcagtcgcagcctcag
gaagatacctccctggaatccgatattccaccacctcctaactctagtcccccagaaaga
ctccagttgtcaccaggatggtgccaacagctcggcccactaaggtgtcctcccttcctc
ctccaccaggaagtgaagcgcagcgtgcccatgccttacatgctcaaggtgcattacaaa
tacacagtggtcatggagactcagcttggcctcccctacagccagcttcggaacatggtg
tctaagaagctggagctcttgccagaacacactaaactgagctaccagcgtcgggacagc
ccggagctgctgctcctgtcagaagaaagcatgaaggatgcctgggcccaagtgaaaaac
tactgcctgaccctctggtgtgagcacacagtgggtgatcaaggttttgtagatgaaccc
aaggaaaaggaaaactctgatgccgataaccggacaacagagcctcagcctaaggaaggg
acccaggtggtagcgatcttcagttatgatgctacccagccagaagacctggagtttgtg
gaaggagatgtgatcttggtgctatcacatgtgaatgaagaatggctggaaggggagtgt
aaagggaaaattggcattttccctaaagcttttgttgaaggatgtgcagccaagaatttg
gaaggcactcccagagaagtatag

DBGET integrated database retrieval system