KEGG   Rattus norvegicus (rat): 364380Help
Entry
364380            CDS       T01003                                 

Gene name
Abhd4, Abh4
Definition
(RefSeq) abhydrolase domain containing 4
  KO
K13698  abhydrolase domain-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    364380 (Abhd4)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S33
   364380 (Abhd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 PAF-AH_p_II Ndr DUF915 Esterase PGAP1 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 364380
NCBI-ProteinID: NP_001102336
RGD: 1311858
Ensembl: ENSRNOG00000009244
UniProt: D3ZAW4
Position
15p13
AA seq 355 aa AA seqDB search
MGWLSSTRQGLFTMADDLEQQPQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARY
VSLPNQNKIWTVTVSPEQKDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGR
SSRPTFPRDPEGAEDEFVTSIETWRETMGIPTMILLGHSLGGFLATSYSIKYPERVKHLI
LVDPWGFPLRPTDPSEIRTPPTWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKR
KFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIY
GANTWIDTSTGKKVKLQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICNSVD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggctggctcagctcgacccggcagggcttgtttactatggctgatgatctggagcag
cagccccagggctggctgagtagctggctccccacttggcgccccacttccatgtctcag
ctgaagaatgtggaagccaggatcctccagtgtctccagaacaagttcctggcccgttat
gtatccctcccaaaccagaacaagatctggacggtgactgtgagcccagagcaaaaggac
cgcacccctctggtgatggtacatggctttgggggtggcgtgggcctctggatcctcaac
atggattccctgagtgcccgccgcacactccatacctttgatctgcttggttttgggcga
agctcaaggcctacgttcccaagggacccagaaggagctgaagatgagtttgtgacctca
atagagacatggcgggagacaatgggaatccctaccatgatcctcctggggcacagtttg
ggaggattcctggccacttcctactctatcaagtaccctgaaagagttaaacatctaatc
ctggtggatccctggggctttcccttacgaccgactgaccccagtgagatccgtacacct
ccaacctgggtcaaggctgtggcatctgtcctgggacgctccaatccactggctgttctt
cgagtggctgggccttgggggcctgggctggtgcagagattccgtccagacttcaagcgc
aaatttgcagacttctttgaagatgataccatctcggaatacatctaccactgcaatgca
cagaatcccagtggggaaacggcattcaaagccatgatggagtccttcggctgggcccgg
cgccccatgttggagcgaatccacttgattcggaaagatgtgcccatcaccatgatctat
ggggccaatacctggatcgacaccagcacagggaaaaaggtgaagctgcaaaggccagac
tcctacgtccgagacatggagatcgagggtgcatcgcaccatgtctacgctgaccagcca
cacatcttcaatgctgtggtggaggagatctgtaactcagttgactga

DBGET integrated database retrieval system