KEGG   Rattus norvegicus (rat): 364405Help
Entry
364405            CDS       T01003                                 

Gene name
Scara3
Definition
(RefSeq) scavenger receptor class A, member 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Filament ABC_tran_CTD AAA_13 TPD52 HrpB7 UPF0242 FliD_C
Motif
Other DBs
NCBI-GeneID: 364405
NCBI-ProteinID: NP_001102340
RGD: 1309269
Ensembl: ENSRNOG00000016177
UniProt: D3ZPA7
Position
15p12
AA seq 606 aa AA seqDB search
MKVRSAGSDRDVLCVTEEDLAGEDEDMSSFPCSQEGRAGPRCNRCQKNLSLHTSVRILYL
FLALLLVAVAVLASLVFRKVDSLSEDISLAQSIYNKKLVSMQENLQGLDPKALINCSFCR
EAEQLGQEIRKLQEELEGLQKMLLAQEVQLDQTSQAHELLSTTSSQISQEMGTCSFSIHQ
VNQSLGLFLAQVRGWQATTAGMDISLKDLTQECYDVKAAVHQINFTVGQTAEWIHGIQRK
TDEETLTLQKIVTDWQNYTRLFGGLRSTSAKTGEIVKTIQATLGASSQRISQNSESMHDL
VLQVMGLQLQLDNISSFLDDHEENMHDLQYHTRYAQNRTVERFESLEGRMASHEIEIGTI
FTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSLMLGTTDLLRERFSLL
SARLDFNVRNLSMIMEEMKAVDTHHGEILRNVTIIRGVPGPPGPRGFKGDTGMKGPVGNK
GPKGDPGSLGPPGPQGPQGQPGEPGPVGERGPAGPRGFPGLKGSKGSFGTGGPRGQPGPK
GDVGPPGPEGPPGSQGPSGPQGKPGISGKAGSPGQRGATGPKGEPGIQGPPGLPGPPGPP
GNQSPY
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagatcagctggcagtgacagggatgtactgtgtgtcactgaagaggacctg
gctggtgaagacgaggatatgtcatccttcccatgctcccaagagggccgggcaggaccc
cgttgcaaccgctgccagaagaacctatctttgcacacatcagtgcggattttgtacctc
ttcctggctctgctcctggtggccgtggctgtgctggcctctctagtttttagaaaggtg
gactctctctcagaagacatctccttggcccagtccatctataataagaagcttgtgtca
atgcaagaaaatcttcaaggactggacccaaaagccctgatcaattgttccttttgccgt
gaggctgagcagctggggcaagagatcaggaagctccaggaggagctggaggggcttcag
aagatgctgctggcccaggaggtccagctggaccagacttcccaggcccatgagctgctc
tccaccacaagcagtcaaatctcccaggagatgggcacttgttccttctccattcaccag
gtcaatcaatccctgggactcttcctggcacaagtgaggggttggcaggccaccacagca
ggtatggacatcagcctgaaggacctcacccaggagtgctatgacgtcaaggctgctgta
caccagatcaacttcacggtgggccagactgctgagtggatccacgggatccagaggaag
acagacgaggagaccctgaccctgcagaagatagtcactgactggcagaactacaccagg
ctctttggaggtttgcgaagcacctctgccaagactggagaaatagtcaagactattcaa
gccaccctgggggcctcctctcagcgcattagccagaattctgagagcatgcatgacctg
gtgctacaggtcatgggcctacagctacaactggacaatatctcttcctttttggatgac
catgaggaaaacatgcatgacctccaataccacacccgatatgcccagaatcgcacagtg
gaaaggttcgagtctctggaaggacgcatggcttctcacgagattgaaattggcaccatc
ttcaccaatatcaatgccactgacaaccacgtgcacagcatgctcaagtacctggacgat
gtacggctgtcttgcacactaggcttccacacccatgccgaggagctctactacctgaat
aagtctgtctccctcatgctgggcaccacagatctgctcagggagcgcttcagtctcctc
agtgctcggttagacttcaatgtccgaaacctctccatgatcatggaggaaatgaaggct
gtggacacacatcacggagaaatccttcgcaatgtcaccatcatccgaggtgtccccggc
cctcccggaccaagaggattcaaaggagatacaggcatgaaaggacctgttggtaacaaa
ggacctaaaggggatcctggcagtctgggaccccccggacctcagggtcctcagggacaa
cctggggaaccaggacctgtgggagaaagagggccagctggcccccgaggctttccaggc
ctcaaaggctcaaagggcagctttggcactggagggccaagggggcagccaggccccaaa
ggggatgtgggacccccagggccagaggggcccccagggtctcaaggaccgtcagggcct
cagggaaagccagggatttcaggaaaggcagggtcaccaggccagcgaggggccacaggg
cctaagggtgaacccggcatccaaggtccccctggactacctggacctccaggtccacca
gggaaccagagcccctactga

DBGET integrated database retrieval system