KEGG   Rattus norvegicus (rat): 365984
Entry
365984            CDS       T01003                                 

Gene name
St6galnac5
Definition
(RefSeq) alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
  KO
K03375  N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7E) [EC:2.4.99.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    365984 (St6galnac5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    365984 (St6galnac5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     365984 (St6galnac5)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   365984 (St6galnac5)
SSDB
Motif
Pfam: Glyco_transf_29 MAGP DUF4578 DUF2722 DUF4834 COX14 TFIIA Gastrin Spt20
Other DBs
NCBI-GeneID: 365984
NCBI-ProteinID: NP_001258290
RGD: 1564252
UniProt: Q6ZXY9
Position
2
AA seq 339 aa
MKTLMRHGLAVCLVLTTMCTSLLLVYSSLGSQKERPPQQQQQQQQQQQQQQQQATATGST
QLVESSPQPHRTAPVGPRQLDGYLGVADHKPLKMHCKDCALVTSSGHLLRSQQGPHIDQT
ECVIRMNDAPTRGYGLDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYM
RRDGKGQVYNNLQLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFT
MTIALELCDRIDVYGMVPPDFCRDPKHPSVPYHYYEPSGPDECTMYLSHERGRKGSHHRF
ITEKRVFKNWARTFNIHFFQPDWKPEPPAVNPAEDKPVF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaagaccctgatgcgccatggtctggcagtgtgtttagtgctcactaccatgtgcacc
agcttgttgctcgtgtacagcagcctcggcagccagaaggagcggcccccgcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcaggcgactgcgactggcagcacg
cagcttgtggagagcagtccccagccacatagaaccgcccccgtaggaccccggcagcta
gacggatacctcggtgtagcagaccacaagcccttgaaaatgcattgcaaggattgcgcc
ctggtgaccagctcggggcacctgctgcgtagtcagcagggcccccacatcgaccagaca
gagtgtgttatccgtatgaatgacgcccccacccgaggctacgggcttgacgtgggcaac
cgcacaagcctgcgagtcatcgcacattccagcatccagaggatcctccgcaaccgccat
gacctgctcaacgtgagccagggcaccgtgttcatcttctggggccccagcagctacatg
cggcgggatggcaagggccaggtgtacaataacctgcagctcctcagccaagtgctgccg
cggctgaaggccttcatgatcacgcgccacaagatgctgcagttcgatgagctcttcaag
caggagactggcaaagacaggaagatctccaacacttggctgagcactggctggttcacc
atgacaattgctctggagctctgtgacaggatcgatgtttacggcatggtgcccccagac
ttctgcagggacccaaagcacccttccgtaccctatcattactatgagccttctggaccc
gatgaatgtacaatgtacctctctcacgaacgaggacgcaagggcagtcaccaccgtttc
attacagagaaacgggtatttaagaactgggcacggaccttcaacattcactttttccaa
ccagactggaaaccagaaccacccgctgtgaatcctgctgaggataagcctgtgttctga

DBGET integrated database retrieval system