KEGG   Rattus norvegicus (rat): 366014Help
Entry
366014            CDS       T01003                                 

Gene name
Zdhhc12
Definition
(RefSeq) zinc finger, DHHC-type containing 12
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    366014 (Zdhhc12)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     366014 (Zdhhc12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC PIG-Y IGFBP
Motif
Other DBs
NCBI-GeneID: 366014
NCBI-ProteinID: NP_001013257
RGD: 1306593
Ensembl: ENSRNOG00000015791
UniProt: Q6DGF5
Position
3p12
AA seq 267 aa AA seqDB search
MALWPLLNSGMLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELFLPLTFLLLVLGSLLL
YLAVSLMDPGYVTAQPQPQEEPKEEQTAMVPQAIPLRRCRYCLVLQPLRARHCRECRRCV
RRYDHHCPWMENCVGERNHPLFVAYLALQLVVLLWGLYLAWSGLQFFQPWGLWLRSTGLL
FTTFLLLSFFALVVSLLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDRGPTRNLA
HFFCGWPSGPWETLWAEEEEEGSSQVV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggctctctggccgctgctcaactctgggatgctggtgcgaactgggcacaccgtgctg
acctggggaatcacgctggtgctcttcctgcacgacaccgagctgcgtcaatgggaagag
caaggggaactgttcctgcccctcactttcctgctcctggtgctgggctcgctgctgctc
tatctggctgtgtcactcatggaccccggctatgtgactgctcagccccagcctcaggag
gagccgaaggaggaacagacagccatggttcctcaggctatcccacttcgacgctgcaga
tactgcctggtgctgcagcccctgcgtgcccgacactgtcgtgagtgccgccgctgtgtt
cgtcgctatgatcaccactgtccctggatggagaactgtgtgggtgagcgcaaccacccg
ctctttgtggcctacctggcactgcagctggtggttcttctgtggggcctgtacctggca
tggtctggtctccagttcttccagccctgggggctgtggctccgatccactgggctcctg
ttcaccaccttcctgctactctccttctttgcattagtggttagcctgctcctggcctcg
cacctctacctggtagccaggaacactactacgtgggagtttatatcctcacaccgaatc
gcctacctccgccagcgcaccagcaacccctttgaccgaggtccgactcgaaacctggcc
cactttttctgtggttggccctctgggccctgggagaccctctgggctgaggaagaggag
gaaggcagcagccaggttgtctag

DBGET integrated database retrieval system