KEGG   Rattus norvegicus (rat): 366163
Entry
366163            CDS       T01003                                 

Gene name
Aqr
Definition
(RefSeq) aquarius intron-binding spliceosomal factor
  KO
K12874  intron-binding protein aquarius
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    366163 (Aqr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    366163 (Aqr)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19-related factors
    366163 (Aqr)
 Complex C
    366163 (Aqr)
SSDB
Motif
Pfam: Aquarius_N AAA_11 AAA_12 AAA_19 ResIII AAA_30 Parvo_NS1 DUF2075 DEAD UvrD_C_2 AAA DnaB_C AAA_16 UvrD-helicase PhoH DUF4088 AAA_22 RecA ATPase
Other DBs
NCBI-GeneID: 366163
NCBI-ProteinID: NP_001094457
RGD: 1306223
Ensembl: ENSRNOG00000008912
UniProt: A3KNA0
Position
3q35
AA seq 1484 aa
MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEEIYEKEIVKSRFA
IRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWETFKKKPDHFP
FFFKRILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQP
ARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSIPLSE
PVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSSLVHREEDGHLFSQ
LLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVD
ARDSLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELLVSRHERRISQIQQ
LNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVT
INLNVRDHIKDEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGM
LDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYDTFNVIMRRK
PKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLS
IEHLKASFPGHNVKVTVNDPALQIPPFRITFPVRSGKGKKRKDADGEEDDTEEAKTLIVE
PHVIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNI
YHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNY
VLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYMSRVKNTGSASPD
AAEVATFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSG
LDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQN
PQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRAR
ASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQN
LGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTV
DRFQGQQNDYILLSLVRTRAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAF
SQLTARPLHLHIIPTEPFPTSRKNGERPPHEVQVIKNMPQMANFVYNMYMHLIQTTHHYH
QTFLQLPPAMVEEGEEVQSQETEMEAEEETGSVQANLTPSPTDASLSQETPTSQPDCSNQ
TEAASSHTEDTSALCDITTAAEPVSAAAEAATPQDGPSVPAETK
NT seq 4455 nt   +upstreamnt  +downstreamnt
atggcggctcctgcgcagcccaagaaaatcgtggcccccaccgtgtcccagatcaacgca
gagttcgtcacccagctggcatgtaaatactgggctcctcatatcaagaagaaatcacct
tttgatataaaagtgatagaagaaatatatgaaaaagagatcgtcaaatcacggtttgcc
atcagaaaaataatgctgctggaatttagccaatatcttgaaaattatctttggatgaat
tattcgccagaagtttccagcaaagcctatttaatgtccatctgctgtatggtgaatgag
aagttcagagaaaatgtcccagcctgggagacctttaagaagaagccagaccacttcccc
ttcttctttaaacgcatcttgaaagcagcactagctgagactgatggcgagttctccctc
cacgagcagaccgtgctcctgcttttcctggatcattgcttcaatagcttggaagtagac
ttgataaggagtcaagtacagcagcttatctcccttcctatgtggatgggcttgcagccg
gcacgattggaattagaattaaaaaagacaccaaagctaaggaaattctggaacttgatt
aaaaagaatgatgaaaagatggacccagaagcaagagagcaggcctaccaagaaaggagg
tttctttcccagctcatccagaagttcatctccgtgttgaagtccatcccactttctgag
cctgtcactatggacaaagttcattactgtgaaagattcatcgaacttatgattgatcta
gaggctctgctccccacaaggcgctggttcaacaccatcctggatgactcccacctcttg
gtgcactgttacctttccagtcttgtccacagggaagaggatggccatctgttttcccag
ctattagacatgctgaagttctatacgggctttgaaattaacgaccagactggaaatgcc
ctgacagagaacgagatgaccacgattcactatgacagaatcacatctctgcagagagct
gcgttcgcgcatttccctgagctctatgactttgccctctccaatgtggcagaagtagat
gcccgggattccttggtcaagttttttgggcctctcagttcaaacacactccaccaggtg
gcatcatacctctgcctcttgccaacgctccctaaaaatgaagatacaacttttgataaa
gagtttcttctagaattgctggtgtctcgccatgaacgccgcatctctcagattcagcag
ttgaatcagatgcctttgtatcctactgagaaaattatctgggatgaaaacatcgtccct
accgagtactattctggggaaggctgtcttgctctccccaagttgaatttgcagttttta
actctacatgactatctcctgaggaactttaatctcttccgcttagaatcaacttatgaa
attagacaagacattgaggacagcgtcagcagaatgaagccatggcaatctgagtatggc
ggtgtcgtgtttggtggttgggcacgaatggctcagcccattgtggctttcactgtagtc
gaggttgccaaacccaacattggtgaaaactggccaacccgagttcgtgcagatgtcacc
atcaatctgaatgtcagagaccacatcaaggatgagtgggaaggtcttcgcaaacacgat
gtatgctttttaattactgtgcgtcccacaaaaccttacggcactaagtttgacaggagg
aggccttttattgagcaagttggtctggtgtacgtcagaggctgtgagatccagggcatg
ctggacgacaaagggcgagtcatcgaagacggacctgaacccagacccaatcttagagga
gagtcaaggacatttcgagtatttttggatccaaaccagtatcaacaggatatgaccaat
actatacaaaatggagccgaagatgtgtacgacactttcaatgtcataatgaggaggaaa
ccaaaggagaataacttcaaggccgtgttggagactattcgaaatctgatgaataccgac
tgcgtggtcccagactggctgcatgacatcattttaggttatggggacccaagtagtgcc
cattattccaaaatgcccaatcagattgctacgttggatttcaatgacacttttctctcc
attgaacatttgaaagccagttttcctggtcataatgtcaaagtgaccgtgaatgaccca
gctctacaaataccccctttcagaataactttcccagtaagaagtggaaaggggaagaaa
agaaaagatgcagatggggaagaagacgacacggaagaagcaaagaccttaattgtggaa
cctcacgttattcctaatagaggtccttatccttacaaccagcccaaacgtaatacaatc
cagttcactcatacacagatagaggccatccgggccggaatgcagcctggactgactatg
gttgtgggaccacctggtacaggaaaaacagatgttgcagtccagatcatttccaacatc
taccacaattttccagaacagaggactttaattgttactcattccaatcaggctctgaac
cagttgtttgagaaaatcatggctttagacattgatgagcgccatctcctgcgtctgggt
catggagaggaagagctagagacggagaaagactttagcaggtatggaagagttaattat
gtcctggctcgaagaatagaacttttagaagaagtcaaacgattacaaaagagtctgggg
gttccgggagatgcttcgtatacctgtgaaactgcaggctatttcttcttatatcaggta
atgtcgcgttgggaagaatacatgagcagagtgaagaacacagggagcgccagcccagat
gctgcggaggtcgccacgttcttccccttccatgagtattttgccaatgctcctcagccc
atctttaaaggcagatcttatgaagaagacatggaaatcgcagaagggtgcttcaggcat
attaagaaaatcttcactcagcttgaggaattcagagcttcagaactgcttcgcagtgga
ctggacaggtctaaatacctcttggtgaaagaagccaaaatcattgctatgacgtgtact
catgctgccttgaaacgacatgacttggtcaagttgggtttcaagtatgacaacatttta
atggaagaggctgctcagattctggagatagaaacctttatcccactacttctgcagaat
cctcaagacggattcagccgattgaaacgatggattatgattggtgatcaccaccaattg
cctccagtcattaagaacatggcctttcagaagtattccaatatggagcagtctcttttt
actcgctttgtccgggttggagttcctactgtggaccttgatgctcaagggagagcccgg
gccagcttgtgtaacctctacaactggcgttacaaaaacctagggaacttgccacacgtg
cagctcctgccagagttcagcacagccaacgcaggcctgctgtacgacttccagctcatc
aatgtggaagacttccagggagtgggagagtcggagcctaacccttacttctaccagaac
ctcggagaggcagagtacgtagtagcgctcttcatgtacatgtgcttgcttggctaccct
gcggacaagatcagcattctgacgacctacaatggacagaagcacctgatccgggacatc
atcaataggcgctgtgggaataatccactcattgggaggccgaacaaggtgacaactgtt
gataggttccaaggtcaacagaatgactacatcctcctttctctagtgcggaccagggcc
gtgggccatttgagggatgtgcgccgcttggtggtagccatgtcgagagccaggcttggc
ctgtatatcttcgctagagtatccctcttccaaaattgctttgaactgactcctgctttc
agccagctcactgcccgcccactgcatttgcatattattccaacagaacctttcccaacc
tccagaaagaatggagagagacctcctcatgaagtacaggtaataaagaacatgccccag
atggcgaattttgtgtacaatatgtacatgcatttgatacagacgacccaccattatcat
cagactttcttacaactaccgcctgccatggtggaagaaggtgaggaggttcagagccaa
gaaacagaaatggaagcagaagaggaaactgggtctgttcaagctaacctcacacccagt
ccaacggatgccagcctgagtcaagagaccccaacttctcagcctgactgctccaatcag
acggaggctgcctccagtcacacagaagatacctctgctctgtgtgacattactactgca
gccgagcctgtctctgcagcggcagaagctgccaccccacaagatgggccttctgttccc
gcagagaccaagtag

DBGET integrated database retrieval system