KEGG   Rattus norvegicus (rat): 366229
Entry
366229            CDS       T01003                                 

Gene name
Scrt2, RGD1564796
Definition
(RefSeq) scratch family transcriptional repressor 2
  KO
K09219  scratch
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    366229 (Scrt2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    366229 (Scrt2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-met Zn-ribbon_8 zf-C2H2_11 HypA zinc_ribbon_15 zf-Di19 zf-BED DZR
Other DBs
NCBI-GeneID: 366229
NCBI-ProteinID: NP_001178834
RGD: 1564796
Ensembl: ENSRNOG00000005148
UniProt: D3ZNS5
Position
3q41
AA seq 305 aa
MPRSFLVKKIKADGFQCSGVPAPTYHPLETAYVLPGTRGPPGDNGYVAHCMPPSGYDGEQ
KPGLELAPTEPAYPAAASEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRR
RRAGAGGDAAGAGDGGGGGERAGRSGATAGGGHRHACAECGKTYATSSNLSRHKQTHRSL
DSQLARKCPTCGKAYVSMPALAMHVLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPF
GCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACVKAAEPPPS
AGPAS
NT seq 918 nt   +upstreamnt  +downstreamnt
atgccgcgttccttcctggtgaagaagatcaaagcggatggcttccagtgcagcggggtg
ccagcccccacctaccaccccctggagactgcctacgtgctgcccggtacccgcgggcct
ccgggggacaacggttatgtggcgcactgcatgccccccagcggttatgatggcgagcag
aagcctgggctggagctggcgcccacagagcccgcctacccggccgcggcgtccgaggag
tacagcgaccccgagagcccacagtccagcctgtcggcgcgctacttccgcggggaggcg
gccgtgaccgacagctactccatggacgccttcttcatttctgatgggcgttcgcggcgg
cgccgggccggggctggcggggacgcggcaggcgcaggggatgggggcggcggcggggag
cgcgcggggcgctcgggggcgacggcgggaggcgggcaccggcacgcatgcgcagagtgc
ggcaagacgtacgccacgtcgtcgaacctgagccgccacaagcagacgcaccgcagcctg
gacagccagctggcgcgcaagtgcccgacgtgtggcaaggcctacgtgtctatgcccgcg
ctcgccatgcacgtgctcacgcacaacctgcgccacaagtgcggcgtgtgcggcaaggcc
ttctcccggccctggttgctccagggccacatgcgctcgcacaccggcgagaagcccttt
ggttgcgcgcactgcggcaaggccttcgccgaccgctccaacctgcgcgcgcacatgcag
acgcactcggccttcaagcactaccgctgccgccagtgcgacaagagcttcgcgctcaag
tcctacctccacaagcactgcgaggctgcctgcgtgaaggccgccgagcctccgccttcc
gccggcccggccagctga

DBGET integrated database retrieval system