KEGG   Rattus norvegicus (rat): 366455
Entry
366455            CDS       T01003                                 

Gene name
Mpl
Definition
(RefSeq) MPL proto-oncogene, thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    366455 (Mpl)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    366455 (Mpl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    366455 (Mpl)
   04090 CD molecules [BR:rno04090]
    366455 (Mpl)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  Prolactin receptor family
   366455 (Mpl)
CD molecules [BR:rno04090]
 Proteins
  366455 (Mpl)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 366455
NCBI-ProteinID: XP_001072502
RGD: 1311069
Ensembl: ENSRNOG00000028377
UniProt: A0A1W2Q6N1
Position
5q36
AA seq 644 aa
MPSWALFMVTSCLLLAPPNQAQVTSQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPS
WIYQLLYAYPGEKPRPCPLHSQSVPTFGTRYVCQFPALDEVRLFFPLHLWVKNVFLNQTL
MQRVLFVDTVGLPAPPSVIKARGGSQPGELQIHWEAPAPEISNFLRHELRYGPTDSSNAT
APSVIQLLSTETCCPTLRMPNPVRVLDQHPCVHPTASQQHGPMRTSPAGEAPSLAVKGGS
CLISGLHAGQSYWLQLRSQPDGVSLRGSWGPWSLPVTVDLPGDAVAIGLQCFTVDLKKVI
CQWQQQDHSSSRGFFRHSRTRCCPTDRDPTWEKCEEEEEEEEEEKEEGELDPGSRPALFS
RCHFKSRNDSVIHILVEVTTAQGAIHSYLGSPFWIRQAVLLPTPSLHWREISSGRLELEW
QHPSPWAAQETCYQLRYTGEGHEDWKVLEPSLGAQGGTLELRPRARYSLQLRARLNGPTY
QGPWSAWSPPARVSTGSETAWITLVTALLLVLSLSALLGLLLLKWQFPAHYRRLRHALWP
SLPDLHRVLGQYLRDTAALSPSKATVTDSCEEVEPSLLEILPKSPERTPLPLCPSQPQMD
YRGLQPCLRTMPLSVCPPTAETGSCCTTHIANHSYLPLSYWQQP
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgccctcttgggccctctttatggtcacctcctgcctcctcttggcccctccaaaccag
gcccaagtcaccagtcaagatgtcttcttgctggccttgggcacagagcccctgaactgt
ttctcccagacatttgaggacctcacctgcttctgggatgaggaagaggcagcacccagc
tggatataccagctgctgtacgcctacccaggagagaagccccgtccatgccccctgcat
tcccagagtgtgcccacctttgggacccggtatgtgtgccagtttccagcgctggatgaa
gtgcgtctcttctttccgctgcacctctgggtgaagaatgtcttcctcaaccagactttg
atgcagcgggtgctgtttgtggataccgtgggcctgccagctcctcccagtgtcatcaag
gccaggggtgggagccaaccaggggaacttcagatccactgggaggcccctgctcctgaa
atcagcaatttcctgaggcatgaactccgctatggccccacggactccagcaacgccact
gcgccctcagtcattcagctgctctccacagaaacctgctgccccactttgaggatgccg
aacccagtccgcgtccttgaccagcatccatgcgttcatcctacagcgtcccagcagcac
ggaccaatgaggacctccccggctggagaagctccctctctggcagtgaagggcggaagc
tgcctcatctcaggcctccatgctggccaatcctactggctccagctacgcagccaaccc
gacggggtctccctccgtggatcctggggaccctggtccctccctgtgactgtggacctt
ccaggagatgcagtggcaattggactccagtgctttaccgtggatctaaagaaggttatc
tgccagtggcagcaacaagaccactctagctcccgaggcttcttccgtcacagcaggaca
cggtgctgccccacagacagggaccctacctgggagaaatgtgaagaggaggaggaggag
gaagaggaagagaaagaggagggggagctggatccaggatcacggcccgctctgttctcc
cgctgccacttcaagtcacgaaatgacagtgttattcacatccttgtagaagtgaccacg
gcgcaaggtgccattcacagctacctgggctcccctttctggatccgccaggctgtgctc
ctccctaccccaagcctgcactggagggagatctcaagtggaaggctggagctggagtgg
cagcacccgtcaccttgggcagctcaagagacctgctaccagctccgctacacaggagaa
ggccatgaggactggaaggtgctggagccatctctcggggcccagggagggaccctagag
ctgcgccctcgagctcgctacagcttgcagctgcgtgccaggcttaacggccccacctac
caaggtccctggagtgcctggtctcctccagctagggtgtccacgggctctgagactgct
tggatcaccttggtgactgctttgctcctggtgctgagcctcagtgcccttctgggccta
ttgctgctgaagtggcaatttcctgcgcactacagaagactgaggcatgctttgtggccc
tcacttcccgacctacaccgggtcctaggccagtaccttagagacactgcagccctaagt
ccttctaaggccacagttactgatagctgtgaagaggtggagcccagcctcctggaaatc
ctacctaagtctccagagaggactcctttgcccctgtgtccctcccagccacagatggac
tacagaggactgcaaccttgcctgaggaccatgcccctgtctgtgtgcccacccacggct
gagacggggtcctgctgtaccacacacattgccaaccactcctacctaccgctaagctat
tggcagcagccctga

DBGET integrated database retrieval system