KEGG   Rattus norvegicus (rat): 366492
Entry
366492            CDS       T01003                                 

Gene name
Epha2
Definition
(RefSeq) Eph receptor A2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    366492 (Epha2)
   04015 Rap1 signaling pathway
    366492 (Epha2)
   04010 MAPK signaling pathway
    366492 (Epha2)
   04151 PI3K-Akt signaling pathway
    366492 (Epha2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    366492 (Epha2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    366492 (Epha2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     366492 (Epha2)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   366492 (Epha2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Pur_ac_phosph_N Interfer-bind Ephrin_rec_like SKG6 SAM_KSR1
Other DBs
NCBI-GeneID: 366492
NCBI-ProteinID: NP_001102447
RGD: 1307204
Ensembl: ENSRNOG00000009222
UniProt: D3ZBN3
Position
5q36
AA seq 977 aa
MKLRAAGFCLALLWGCALAAAAAQGKEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMND
MPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNL
YYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLA
FQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDAQPLATVAGTCVDHAVVPYG
GEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACQACSPGFFKSEASESPCLQCPEHTLP
STEGATSCQCEEGYFRAPEDPLSMPCTRPPSAPHYLTAIGMGAKVELRWTAPQDTGGRKD
IVYSVTCEQCWPESGECGSCEASVQYSEPPQALTRTSVTVSDLEPHMNYTFTVEARNGVS
DLVNSRSFRTASVSINQTEPPKVRLEDRSTTSLSVAWSIPVPQQSRVWKYEVTYRKKGDA
NSYNVHRTDGFSVTLDGLAPGTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSATMAVIG
GVAVGVVLLLVLAGIGFFIHRRRRNLRARQSSEDVYFSKSEQLKPLKTYVDPHTYEDPNQ
AVLKFTTEIHPSCVSRQKVIGAGEFGEVYKGTLKSSSGKKEIPVAIKTLKAGYTEKQRVD
FLSEASIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGM
LRGIASGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKI
PIRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTP
MDCPSAIYQLMMQCWQQERSRRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTS
GSEGVPFRTVSEWLESIKMQQYTEHFMVAGYTAIEKVVQMSNDDIKRIGVRLPGHQKRIA
YSLLGLKDQVNTVGIPI
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgaagcttcgggcagccggtttctgcctggccctgttgtggggttgcgcgctggcggcc
gcggcggcacagggaaaagaagttgttttgctggacttcgcagcaatgaagggggaactc
ggctggctcacacacccctacggaaaagggtgggacctgatgcaaaacatcatgaatgac
atgcctatctacatgtactccgtgtgcaatgtggtgtctggcgaccaggacaactggctc
cgtaccaactgggtgtaccgggaggaggccgagcgcatctttattgagctcaagttcacc
gtgcgagactgcaatagctttccgggtggcgccagctcctgcaaagagaccttcaacctc
tactatgcagagtcagacgtggactatggcaccaacttccagaagcgccagttcaccaag
atcgacaccatcgcccctgacgagatcacggtcagcagtgacttcgaggctcgcaatgtc
aagctgaatgtggaggagcgcatggtggggccccttacccggaagggcttctacctggcc
ttccaggacatcggtgcctgtgtggcattgctctctgttcgtgtctactacaagaagtgt
cccgagatgcttcagagcttggcccgcttccctgagaccattgctgtcgccgtctcagat
gcacagcccctggccacggtggccggtacctgcgtggaccacgctgtggtgccttatggg
ggcgaggggcctctcatgcactgcacggtggatggtgagtggctggtgcctatcgggcag
tgcctgtgccaagaaggctacgagaaggtggaggacgcctgccaagcctgttctccagga
ttcttcaagtctgaggcatctgagagcccttgcctgcagtgtccggagcataccctgcca
tccactgagggtgccacctcctgccagtgtgaagaaggctatttcagggcacctgaggac
ccactgtccatgccctgcacacgtccaccctctgccccccactacctcacggccatcggc
atgggtgccaaagtagaactgcgttggacggccccccaggacaccggtgggcgcaaggac
atcgtctacagcgtcacttgcgaacagtgctggccagagtccggcgagtgtgggtcctgt
gaggccagtgtgcaatactcagaaccacctcaggccctgacccgcacgagtgtgacagtc
agcgacctggagcctcacatgaactataccttcactgtcgaagcccgcaatggcgtctca
gacctggtgaatagccgaagcttccggactgccagtgtcagcattaaccaaacagagccc
cccaaggtgagactggaggaccgaagcaccacctccctgagtgtcgcctggagcatcccg
gtgccacagcagagccgtgtgtggaagtacgaagtcacctaccgcaagaagggggatgcc
aatagctacaatgtgcaccgtacagacggcttctccgtgaccctggatggccttgctccc
ggtactacatacctggtgcaggtgcaggcgctgacgcaggagggccagggcgccggcagc
aaagtgcacgagttccagacgctgtccacggaaggatctgccaccatggcggtgatcggc
ggtgtggctgttggcgttgtcctgctcctagtgttagcgggaattggcttcttcatccat
cgaaggaggaggaacctgcgggcccgtcagtcctctgaggacgtctacttttccaagtca
gaacaactaaagcccctgaagacatatgtggatcctcacacttacgaagaccccaaccag
gccgtgctcaagtttaccaccgagatccacccatcctgtgtctccaggcagaaggtcatt
ggagcaggagagtttggagaggtatataaagggacgctgaagtcctcctctgggaagaag
gagataccggtggctatcaagacgctgaaagccggctacactgagaagcagcgggtggac
ttcctaagtgaagccagcatcatgggccagttcagccatcacaatatcatccgcctggag
ggcgttgtctctaaatacaaacccatgatgattatcacagagtacatggagaatggagcg
ctagacaagttccttagggagaaggacggcgagttcagcgtactgcagctcgtgggcatg
cttcggggcatcgcgtctggcatgaagtacctggccaacatgaactacgtgcaccgggac
ctggccgcccgcaacatccttgtcaacagtaacctggtatgcaaggtgtccgattttggc
ctgtcgcgtgtgctggaggatgaccctgaggccacctacaccactagtggcggcaagatt
cctattcgatggacagccccagaagccatttcctaccgcaagttcacctcagccagtgat
gtgtggagctatggaattgtcatgtgggaggtgatgacgtacggagagcggccctattgg
gagctgtcaaaccatgaggtcatgaaagccatcaacgatggcttccggctccccacgccc
atggactgcccctcagccatctaccaactcatgatgcaatgctggcagcaagagcgctcc
cgccggcccaagtttgctgacattgttagcatcttggacaagctcatccgagcccccgac
tccctcaagaccctggctgacttcgatccccgagtgtccattcggctacccagcaccagc
ggctcagagggagtccccttccggacggtgtctgagtggctggaaagcatcaaaatgcaa
cagtatacggaacacttcatggtagctggctacacggccatcgagaaagtggtgcagatg
tccaatgatgacatcaaaaggatcggagtgcgtcttcctggccaccagaagcgcattgcc
tacagcctgctgggactcaaagaccaagtgaacacagtggggattcctatctga

DBGET integrated database retrieval system