KEGG   Rattus norvegicus (rat): 366608
Entry
366608            CDS       T01003                                 

Gene name
Dock4
Definition
(RefSeq) dedicator of cytokinesis protein 4 isoform X1
  KO
K17697  dedicator of cytokinesis protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    366608 (Dock4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    366608 (Dock4)
   03036 Chromosome and associated proteins [BR:rno03036]
    366608 (Dock4)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    366608 (Dock4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    366608 (Dock4)
SSDB
Motif
Pfam: DHR-2 DOCK_N DOCK-C2 SH3_2 SH3_1 Aida_C2
Other DBs
NCBI-GeneID: 366608
NCBI-ProteinID: XP_038934052
RGD: 1561724
Ensembl: ENSRNOG00000004823
Position
6
AA seq 1978 aa
MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSS
YVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGSMWKQLYVRNEGDLFHRLWHIMN
EILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITEL
YRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLR
LNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
FGCAVLSIADLLTGETKDDLVLKVYMCNTESEWYQIHENIIKKLNARYNLTGSNAGLAVS
LQLLHGDIEQIRREYSSVFSHGVSITRKLGFSDIIMPGEMRNDLYITVERGEFEKGGKSV
ARNVEVTMFIVDSNGQPLKDFISFGSGEPLASEYHSFVLYHNNSPRWSELLKLPIPVDKF
RGSHIRFEFRHCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTT
RYLKFPFSKVIFLGNNNQTMKATKESFWITSFLCSTKLTQNGDMLDLLKWRTHPDKITGC
LSKLKEIDGSEIVKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPV
MDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFS
LATGGQNEEEFRCCIQELLMSVRFFLSQESKGTGALSQSQAVFLSSFPAVYSELLKLFDV
REVANLVQDTLGSLPTIMHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHI
HLQEQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQAS
SSAMRLQFQDVTGEFVACLLSLLRQMTDRHYQQLLNSFNTKEELRDFLLQIFTVFRILIR
PEMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCL
QLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPALIGPFLEVTLIPQPD
LRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGP
YPSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKIGEVDGKKIGCTVSLLNFYKT
ELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQR
KEHLHLTIIQNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQR
LEPEFFRVGFYGKKFPFFLRNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDET
IFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKEN
EFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQ
SRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFFVKDYILSHPEDGEKIARLRELMLEQA
QILEFGLAVHEKFVPQDMRPLHKKLVDQFFVMKSSFGIQEFPACIQASPVHFPNGSPRVC
RNSAPASMSPDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQ
PSPSTSSLSSTHSASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRDRPCSAIYPTPV
EPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVP
PRPTQTASPARHTTSVSPSPAGRSPLKSSVQSFTPSPVEYNSPGLSSNSPVLSGSYSSGI
SSLSRCSTSETSGFENQANEQSVPVPVPVPVPMPVPSFSGSEEPVRKESKTPPPYSVYER
TLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGTRRTEPGPRPRPLPRKVSQL
NT seq 5937 nt   +upstreamnt  +downstreamnt
atgtggatacctacggagcacgagaaatacggcgtggttattgccagttttcgaggcacc
gtcccatatggcctgtcattggaaattggagatactgttcagatcctggagaagtgcgat
ggctggtacagaggatttgccttaaaaaaccccaatatcaagggtatatttccttccagc
tatgttcacttgaaaaatgcctgtgtaaagaacaaaggacaatttgagatggttattccc
actgaagattctgttatcacagagatgacatcaacattaagagactggggaagcatgtgg
aaacaactctatgtcagaaatgaaggggatctcttccaccgcctgtggcacatcatgaat
gaaatcctcgatctgcggcggcaggtgctagtcggccacctcacccacgacaggatgaag
gatgtgaagcgtcatattactgcgcggctggattggggaaatgaacaactgggactcgac
ctggtgcctaggaaggagtacgcaatggtagacccagaggacatcagcatcactgagctg
taccgactgatggaacatcgacatcggaagaaggacactcctgtgcaggccagcagtcac
catctctttgtccagatgaagagcctcatgtgttccaacctgggagaggagctggaggtc
atcttctcgctcttcgacagtaaagagaatcgcccaatcagtgagagatttttcttgaga
ctgaataggaatgggcttcccaaagccccggataagcccgaaagacactgttctctcttt
gtggacttgggcagcagtgaactcaggaaggacatctatattaccgtgcacattatccga
attggacgaatgggagcaggagaaaaaaagaacgcctgcagtgttcaatatcggcgaccg
tttggctgtgcggttcttagcattgcagaccttctcacaggagagacgaaggatgacctt
gtcctgaaagtgtacatgtgtaatacagagagtgagtggtaccagatccacgagaacatc
atcaaaaagctgaatgcacgctacaatttgactggctccaatgcaggattagcagtttcc
ctccagctgttacacggagacattgaacagatcagaagagaatactcctcggtgttctct
cacggagtatccataactcggaagctgggtttttctgacattataatgcctggtgaaatg
aggaatgatttatatatcaccgtagaaaggggagagtttgagaaaggcggcaagagtgtg
gccagaaatgtggaagtcacaatgttcatagtagacagtaatggtcagcccttaaaggat
tttatctcctttggttctggagagccactggctagtgagtaccactcctttgtgctttat
cacaacaacagtcccaggtggtcggagctgctgaaacttcccattcctgtggataaattc
aggggctcccacatccgctttgagttccggcattgttccacaaaggagaaaggagagaag
aagttgttcggtttctctttcgtacccttgatgcaagaggatggaaggactctcccagat
ggcacacacgagctcatcgtgcataagtgtgaagaaaacacaaaccttcaggatactacc
cgctacctcaagtttccattttccaaggtcatcttccttgggaacaataatcaaaccatg
aaggccacaaaggaatccttttggataacatcatttctgtgttccacaaaactcactcag
aatggtgatatgcttgatcttttgaaatggagaacccacccagacaagatcacaggctgt
ctctctaagttaaaagaaatcgatggctcagagatagtaaagtttctccaagacacactg
gataccttgtttggaatattagatgaaaattcccaaaaatatgggtctaaagtatttgat
tctttggtccacataataaatttgctacaagatagcaagttccatcattttaagcctgtc
atggacacttacattgagagtcactttgctggggcacttgcatacagagatctcatcaaa
gtgctcaagtggtacgtggacaggataacggaagcagagcgccaggagcatatccaggaa
gtgttgaaggcacaagaatacatttttaagtatatagttcaatcccgaaggctgttttcc
ctggccactggagggcagaatgaagaggaattccgctgctgcatccaggagctcctcatg
tctgtccgcttcttcctctcacaagagagcaaagggactggagcgttatctcagtcacag
gctgtgttcctgagctccttcccagctgtgtattcagaactgttgaagctctttgatgtc
cgggaagtggccaacttggtacaggacaccctgggcagcctgccgaccatcatgcatgtg
gacgattccctgcaggcgatcaagcttcagtgcattggcaaaactgtagagagccagctc
tacaccaacccagactcaaggtacattctcctgcctgtcgtactgcatcacctccacatt
cacttgcaagaacagaaggacttgatcatgtgtgcacgtatccttagcaacgtattctgt
ctcatcaagaaaaatagctcagaaaagtctgtactggaggaaatagacgtgatcgtggcc
agcttgctggatatcctgctcaggaccatactggagatcaccagtcggcctcaagcatcc
agctccgccatgaggctgcagttccaggatgtcactggggaatttgttgcctgtctcctt
tccctattacgacaaatgacagatagacattatcagcaacttctgaatagtttcaatact
aaagaggagctgagggatttcttgctgcagatttttaccgtgttccgaatattgatacgc
ccagagatgtttcccaaggactggactgtcatgcgcctggttgctaacaatgttatcatt
acaaccgttctgtacctctccgatgctctccgtaagaacttcttaaatgaaaactttgat
tataagatctgggattcctacttttacctcgctgtcatttttataaaccagttgtgtctg
cagctggagatgttcacaccttccaaaaagaaaaaggtgctagaaaagtatggtgatatg
cgggtcaccatgggttgtgaaattttcagcatgtggcaaaacctaggagaacacaaactt
catttcatcccggccctgattgggccctttctggaagtgaccttgataccccagccagat
ctccggaacgtcatgattcctatttttcacgatatgatggattgggagcaaaggagaagt
ggcaactttaagcaggtggaagccaagctaattgacaaattggatagcctgatgtcagag
ggcaaaggtgatgaaacataccgtgagctcttcaacagtataattccactatttggtccc
taccctagtctactaaagaaaattgagcgggaaacatggagggaaagtggcgtttcatta
attgccactgtcactcggctgatggagaggttgttagactacagggactgcatgaaaata
ggagaagtggatggcaagaagattggctgcacagtgagcctgctgaacttctataagacg
gagctgaacaaggaggagatgtacatccgctacatccacaaactctatgatctgcatctc
aaggcgcagaacttcacagaggctgcctacaccctcctgctgtatgacgagctgctggag
tggtctgatcggcccctcagggagttcctgacctaccccatgcagactgagtggcagcgc
aaggagcacctgcacctcaccatcatccagaactttgatcgaggcaaatgttgggagaat
ggcattatcctgtgccggaagattgcagagcaatatgagagttactatgactacaggaac
ctgagcaagatgaggatgatggaagcctctttgtatgacaaaatcatggaccaacagcgt
ctggaacctgaattcttcagagttggattttatgggaagaagtttccatttttcttaaga
aataaggagtttgtatgtcgagggcatgactacgaaagactggaggctttccaacagcga
atgctgaacgagttcccccatgccatcgccatgcagcacgccaaccagcctgacgagacc
atcttccaggcggaagctcagtatttacagatatatgctgtgactcccattccagagagc
caggaggtgctgcagagagaaggggttccggacaacatcaaaagcttctataaagtgaat
cacatctggaagttccgctatgacagaccgttccacaaaggcacaaaagacaaggagaac
gagttcaagagtctctgggtggaaagaacatcgctgtacttggtgcagagcttgcctggc
atctcccgctggttcgaagtggaaaagcgtgaagtggtggaaatgagtcctctggaaaat
gccatcgaagttttagaaaataagaaccagcagctgaagaccctgatcagccagtgtcag
agcaggcaaatgcagaatatcaaccccttgaccatgtgcctcaacggagtcatagatgca
gcggtgaatggaggggtttccaggtaccaagaggcgttctttgtcaaagactatatttta
agtcatcctgaagacggggagaagattgcacggttaagagagctgatgcttgagcaggca
cagattctggaatttgggctggccgtgcatgagaaattcgtacctcaagacatgaggccc
cttcacaaaaaactggtggaccagttctttgtgatgaaatcgagcttcgggatacaggag
ttccctgcctgtatccaggccagccctgtccattttcctaacggaagcccccgtgtgtgt
agaaactcagcccctgcttccatgagtccagatggtaccagggtaatccctagacgcagc
ccattaagttacccagctgtcaaccggtactcctcgtcctcgctgtcctcccaggcctct
gctgaagtaagcaatattacagggcaatcagaaagctctgatgaagtctttaacatgcag
cccagcccatctacctcaagcctgagttccactcactctgcttcacctaatgtgacgagt
tctgctccgtcgagcgccagagcttcacctctgttgtctgacaaacacaaacattccaga
gaaaactcttgcctgtccccgagagatagaccgtgcagtgccatttacccaacgcctgtg
gagccttcccagaggatgctgtttaatcatattggagatggggccttgcctcgcagtgac
cccaacctttctgcacctgagaaagctgtgaatcccacccctagcagttggagcctggac
agtgggaaagaagccaagaacatgtcggacagtgggaaacttatctctccccctgtccct
ccaaggcccacacagactgcttcgccagcaagacacacaacatccgtgtccccctcacct
gctggacggtctccattgaagagctctgtacagtctttcaccccatctccagtggagtac
aactccccaggactgagctccaactccccagtcttgtccggcagctacagcagtggaatc
tcctcgcttagccggtgtagcacttcagaaacctccggctttgaaaaccaagccaacgaa
cagtcggtgcctgtgccggtgcccgtgcccgtgcccatgccagtgcccagcttcagcggg
tcggaggaacctgtacgcaaggaaagcaaaaccccgcccccctacagtgtctacgagcgg
actctgcgacgccctgtcccgctacctcacagcctctccatccctgtcacctctgagcca
cctgctctgccccccaagcccttggcagcgcggtccagccacctggagaatggaacccgt
aggactgagcctggcccgaggcccaggcccctgccccgcaaggtgtctcagctctaa

DBGET integrated database retrieval system