KEGG   Rattus norvegicus (rat): 366951
Entry
366951            CDS       T01003                                 

Gene name
Scrt1
Definition
(RefSeq) scratch family transcriptional repressor 1
  KO
K09219  scratch
Organism
rno  Rattus norvegicus (rat)
Brite
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    366951 (Scrt1)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-met zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 zf-Di19 zinc_ribbon_15 HypA zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 366951
NCBI-ProteinID: NP_001124042
RGD: 1306236
Ensembl: ENSRNOG00000025594
UniProt: D4A919
Position
7q34
AA seq 348 aa
MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYVGPASVYDGDAEAALL
KGPSPEPMYAAAVRGELGPAASGSAPPPTPRPELATAAGGYINGDAAVSEGYAADAFFIT
DGRSRRKAANANAASAPSTASVAAPDSDAGGGGGPGTRGSGSGSASRGGTRVGAGTEARA
GPGATGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMH
LLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSA
FKHFQCKRCKKSFALKSYLNKHYESACFKGGASGPATPAPPQLSPVQA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcccaggtccttcctggttaagaaggtcaaacttgacacattctcttcggcagacctc
gacagctcctacgggcgcgcccgcagcgatctcggagtgcgactgcaagataaaggatac
ctcagtgactacgtggggcctgcgtcggtctacgatggcgacgctgaggcggcattgctc
aaagggccatccccggagcctatgtatgctgcggctgtgcggggagagctgggtcccgcg
gcctctggctcagcaccgccgcccacccctcgcccagagctggctactgctgctggcggc
tacatcaacggcgacgcggcggtcagcgaaggctacgcggccgacgccttcttcatcact
gacgggcgctcacgccgtaaggctgctaatgccaacgctgcctcggccccctcgacagcc
tcggtggcagcccccgacagcgacgctggaggtgggggcgggccgggcacgcgaggctct
ggatcagggtccgctagtcggggtggtacgcgcgtgggggcgggcaccgaggcgcgtgcg
gggccgggagccacgggcgctggtggccggcacgcgtgcggagagtgtggcaaaacttac
gccacgtcgtcgaacctgagccgccacaagcaaacgcaccgcagcttggacagccagctg
gcaaggcgttgcccaacgtgtggcaaggtgtacgtgtccatgccggccatggctatgcac
ctgctcacgcacgacctgcgccacaagtgcggcgtgtgcggcaaagccttctcccggccc
tggctgctgcagggccatatgcgctcgcacacgggcgagaaacccttcggctgtgcgcac
tgcggcaaggccttcgcagaccgctccaacctgcgcgcacacatgcagacgcactccgcc
ttcaagcacttccagtgcaagcgctgcaagaagagcttcgcgctcaagtcttatctcaac
aagcactacgagtcagcctgcttcaagggcggcgccagcggccccgcaacccctgcgccg
ccgcagctcagcccggttcaagcctag

DBGET integrated database retrieval system