KEGG   Rattus norvegicus (rat): 366962
Entry
366962            CDS       T01003                                 

Gene name
Grap2
Definition
(RefSeq) GRB2-related adaptor protein 2
  KO
K07366  GRB2-related adaptor protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    366962 (Grap2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   366962 (Grap2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_3 SH2_2
Other DBs
NCBI-GeneID: 366962
NCBI-ProteinID: NP_001030116
RGD: 1307605
UniProt: Q3KR57
Position
7q34
AA seq 326 aa
MEAIAKFDFMASGEDELSFHTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIKFPEWFH
EGLSRHQAENLLMGKEIGFFVIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTE
KFPSLNKLVDYYRTTSISKQKQIFLRDGTQDQQGHRGNSLDRRTQGGPPREVPSGTAGEE
IRPLMNRKLSDHLPLGTQQFHPHQQLPPQFPPGPQPPPQQRYLQHFHQDRRGGSLDINDG
HLGIGSEMNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGLRSGEVVEVLDSS
NPSWWTGRLHNKLGLFPANYVAPMMR
NT seq 981 nt   +upstreamnt  +downstreamnt
atggaagctattgccaagttcgatttcatggcctcgggtgaggacgaattgagctttcac
actggagatattctgaagatcctaagcaaccaggaggagtggctcaaggcggagcttgga
agccaagaaggatatgtgcctaagaattttatagatatcaagtttcctgagtggttccat
gaaggcctctctcgacatcaggcagaaaacttactcatgggcaaggaaattggattcttc
gtcatcagggccagtcagagttcaccaggagacttctccatctctgtcaggcatgaggac
gatgttcagcacttcaaagtcatgcgagacaccaagggcaattacttcctgtggactgag
aagttcccatccctaaataagctggtggactactaccggacaacttccatctccaaacag
aagcagatcttccttcgggatggaacccaagatcagcagggtcaccggggcaacagcctg
gacaggagaacccagggaggccctcccagggaggttccaagtgggaccgcaggagaagaa
atccgacccttgatgaaccggaagctgtcagaccaccttcctctgggtacccagcagttc
cacccgcaccagcaactgcccccccagttcccaccagggccccagccccctccacagcag
cgctatctgcagcattttcaccaggaccgtcgtggaggcagcctggacataaacgatgga
cacctcggcattggcagtgagatgaatgccaccctgatgcaccggagacatacagacccc
gtacaactccaggcggcagggcgagtgcgctgggccagggcactctatgactttgaggcc
ctggaggaagatgagctggggctcagaagtggagaggtggtcgaagtcctggacagctcc
aacccgtcttggtggaccggccgcctgcacaacaaactgggtctcttccctgccaactat
gtggcccccatgatgcgatga

DBGET integrated database retrieval system