KEGG   Rattus norvegicus (rat): 367323
Entry
367323            CDS       T01003                                 

Gene name
Nudt12
Definition
(RefSeq) nudix hydrolase 12
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    367323 (Nudt12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    367323 (Nudt12)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     367323 (Nudt12)
SSDB
Motif
Pfam: NUDIX Ank_2 Ank_5 Ank_4 zf-NADH-PPase Ank_3 Ank NUDIX-like DNA_ligase_ZBD Cupin_3
Other DBs
NCBI-GeneID: 367323
NCBI-ProteinID: NP_001102480
RGD: 1310902
Ensembl: ENSRNOG00000022576
UniProt: D4A2H8
Position
9q36
AA seq 462 aa
MSSVKRNPKREIISELHSSAAEGDVAKLAGILSHSPSLLNETSENGWTALMYAARNGHPD
AVQFLLEKGCDRSSVNKSRQTALDIAVFWGYKHIANLLANAKGGKKPWFLTSDVDGCENY
FSRTLLDRRSDKRTNSDWLQAKESHPTTVYILFSDLNPLVTLGGNKESSQQPEVRLCQLN
YADIKDYLAQPEKITLVFLGVELEMRKGSHAHAGGVPEGEEDGLVAWFVLGIEPGAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSTTKIEEGGYKR
VCVRENCPSLHGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVGEESGVKVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDAR
WFTREQVVDVLTKGKQQAFFVPPSRAIAHQLIKHWVGMNPSL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcttctgtcaaaagaaatcccaaaagggaaataatttctgaactccacagttcagcc
gcagaaggagacgtcgcgaagttagcaggaattctcagtcattctccatctcttctcaac
gagacttctgaaaacggatggactgctttaatgtatgccgccaggaacgggcatccggat
gctgtccagtttctgcttgagaaaggatgtgacagatcgtctgtcaataaatcgaggcaa
accgccctggatattgcggtattttggggttataagcatatagctaacttattggctaac
gccaaaggagggaagaagccctggttcctaaccagtgacgtagacggatgtgaaaattat
tttagcagaacactgctggaccggaggagtgacaaaaggactaattctgactggctgcaa
gctaaagagagccaccccaccacagtttatatccttttctctgacttgaaccccctggtt
actctaggtggtaataaagaaagctcgcagcagccggaagtcaggctctgccagctgaac
tacgcggacataaaggattacttggctcagcctgagaagatcaccttggtgttccttgga
gtcgagcttgaaatgagaaaaggctcgcacgcccatgccggcggagtcccagagggagag
gaggatggtttggttgcatggtttgtcctcggcatagaacctggtgcagctgaggagttt
aagcaaagacacgaaaactgttactttctccacccgccaatgcccgctcttctgcagttg
aaagaaaaagaggctggggtcgtggctcaagcaagatcggtgcttgcgtggcacagtcga
tacaagttctgcccaacctgtggcagcacaactaaaattgaagaaggtggctacaaaaga
gtgtgtgttcgagaaaactgccctagtctccatggcgtccacaacacatcttacccgaga
gttgatccagtcgtaattatgcaggtcattcatccggatggaaccaagtgtcttttaggc
cggcaaaagagatttccccccggcatgttcacttgtctcgctggatttatcgagcctggg
gagacaatagaagacgctgtgcggagagaggtaggagaggaaagtggagtcaaagttggc
catgttcagtatgtctcttgtcagccgtggccaatgccctcctctttaatgattggctgt
ttagctgtggcagtgtctacagaaattaaagttgacaagaatgaaatagaggatgcccga
tggttcactagagaacaggtggtggatgttcttaccaaagggaagcagcaagcattcttc
gtgccaccaagccgagctattgcacatcagttaatcaagcactgggttggcatgaacccc
agtctctaa

DBGET integrated database retrieval system