KEGG   Rattus norvegicus (rat): 367832Help
Entry
367832            CDS       T01003                                 

Gene name
Zfx, RGD1562664
Definition
(RefSeq) zinc finger protein X-linked
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Zfx_Zfy_act zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zinc_ribbon_15 zf-BED zf-C2H2_11 zf-met zf-C2H2_3rep
Motif
Other DBs
NCBI-GeneID: 367832
NCBI-ProteinID: XP_006257092
RGD: 1562664
Ensembl: ENSRNOG00000005624
Vega: OTTRNOG00000000350
UniProt: A0A096MJV6
Position
Xq22
AA seq 799 aa AA seqDB search
MDEDGLELQPQAPNSFFDATGAGATHMDGNQIVVEVQETVYVSDVVDSDITVHNYVPDDP
DSVVIQDVIEDVVIEDVQCTDIMDEADVSETVIIPEQVLDSDVTEEVSLTHCTVPDDVLA
SDITSASISMPEHVLTSESIHVSDVSHVEHVVHDSVVEAEIVTDPLTADVVSEEVLVADC
ASEAVIDANGVPVNQQDEDKANCEDYLMISLDDAGKIEHDGSSGLTMDNETEIDPCKVDG
TCPEVIKVYIFKADPGEDDLGGTVDIVESEPENEHGVELLDPNNSMRVPREKMVYMAVND
TQQEEEELNVAEIADEVYMEVIVGEEDAAAAAAAAVHEQQVEDNEMKTFMPIAWAAAYGN
NSDGIENRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGHPLTVYP
CMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAEK
AIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNF
PHICVECGKGFRHPSELKKHMRIHTGEKPYECQYCEYRSADSSNLKTHVKTKHSKEMPFK
CDICLLTFSDTKEVQQHALIHQESKTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDM
CDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRCRK
GFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFR
RPSEKNQHIMRHHKEVGLP
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagatggacttgaattacaaccacaagcaccaaactcattttttgatgcaaca
ggagctggtgctacacacatggatggaaatcaaattgttgtggaagtacaagaaacggtt
tatgtgtcagatgttgtggattcagacataaccgttcataactacgttcccgatgaccca
gactcagttgtaatccaagatgttattgaggatgttgttatagaagatgtccaatgtaca
gatatcatggacgaagcagatgtgtccgaaacagtcatcatccctgaacaagtcctggat
tcagatgtaaccgaagaagtttctttaacgcattgcacagttccagatgatgttttagct
tccgatattacttcagcctcaatatctatgcctgaacatgtcttgacaagtgaatctata
catgtgtctgacgttagtcacgttgaacatgtggttcatgatagtgtagtagaagcagaa
atcgtcacagatcctctgaccgctgatgttgtttcggaagaagtgctggtagcagactgt
gcctctgaagcagtcatagatgccaacggggtccctgtgaaccagcaggatgaagacaaa
gccaactgtgaggactaccttatgatctctttggatgatgctggtaaaatagaacatgat
ggttcatctggactgactatggacaacgaaacagaaattgatccttgtaaagtggatggc
acttgccctgaagtcatcaaggtgtacatttttaaagctgatcctggagaagatgactta
ggtggaaccgtagacattgtggaaagcgagcctgagaacgagcatggggttgaactgctt
gatccaaacaacagtatgcgtgttcccagagaaaagatggtttatatggctgttaatgac
actcagcaagaagaggaagaattgaatgttgctgaaattgctgatgaagtttatatggaa
gtgattgttggagaggaggatgctgcagccgcagctgcagccgcagtgcatgaacagcaa
gtggaggacaacgaaatgaaaaccttcatgccgattgcgtgggcagctgcttacggtaat
aattctgatggaattgaaaaccggaatggcactgcaagtgccctcttgcacatagatgag
tctgctggcctcggcagactggctaaacaaaaaccaaagaaaaggagaagacctgattcc
aggcagtaccaaacagcaataattattggcccagatggacatcctctcactgtctaccct
tgcatgatttgtggcaagaagtttaaatcgagaggtttcttaaaaagacacatgaaaaac
catcctgaacaccttgccaagaaaaagtaccgctgtactgactgtgattacactaccaac
aagaagataagtttacacaatcacctggagagccacaagctaaccagcaaggcagagaaa
gccatagaatgcgatgagtgtggaaagcatttctctcatgctggggctttgtttactcat
aaaatggtgcataaggaaaaaggagccaacaagatgcacaagtgtaagttctgtgaatat
gaaacagctgaacaaggcctattgaatcgccaccttttggcagtccacagcaagaatttt
cctcatatttgtgtagagtgtggcaaaggtttccgtcatccatcagagctcaaaaagcac
atgcgaatccatactggagaaaagccctatgaatgccagtactgcgaatacaggtccgca
gattcttctaacttgaaaacacatgtaaaaactaagcatagtaaagagatgccattcaag
tgtgacatttgtcttctgactttctcagataccaaagaggtgcaacaacatgctcttatc
catcaagagagcaaaactcaccagtgtttgcattgtgaccacaagagttcaaactcaagt
gatttgaagcgacacataatttcagttcatactaaggactatcctcataagtgtgacatg
tgcgataaaggctttcacaggccttcagaactcaagaaacatgtggctgcccacaagggt
aaaaaaatgcaccagtgtagacattgtgactttaagattgcagatccgtttgtactaagt
cgccatattctctcggttcatacaaaggaccttccatttaggtgtaagagatgtagaaag
ggatttcggcaacaaagtgagcttaaaaagcatatgaagacccacagtggccggaaggta
tatcagtgtgagtactgtgaatatagcactacagatgcgtcaggctttaagcggcacgtt
atctccattcatacgaaagactatcctcaccgctgtgagtactgcaagaaaggattccga
agaccctcggaaaagaaccagcacataatgcgacatcataaagaagttggcctgccctaa

DBGET integrated database retrieval system