KEGG   Rattus norvegicus (rat): 367901
Entry
367901            CDS       T01003                                 

Gene name
Btk
Definition
(RefSeq) tyrosine-protein kinase BTK
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno05169  Epstein-Barr virus infection
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    367901 (Btk)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    367901 (Btk)
   04662 B cell receptor signaling pathway
    367901 (Btk)
   04664 Fc epsilon RI signaling pathway
    367901 (Btk)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    367901 (Btk)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    367901 (Btk)
  09163 Immune disease
   05340 Primary immunodeficiency
    367901 (Btk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    367901 (Btk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     367901 (Btk)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  TEC family
   367901 (Btk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 SH3_10 ABC1 Kdo Pkinase_fungal APH Haspin_kinase SH3_4
Other DBs
NCBI-GeneID: 367901
NCBI-ProteinID: NP_001007799
RGD: 1359683
Ensembl: ENSRNOG00000052407
UniProt: Q5S255
Position
X
AA seq 660 aa
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPVPRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEE
LRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGS
SHRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTSELKKVVALYDYMPMNANDLQLRKGE
EYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEG
KEGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELI
NYHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYG
KWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMAN
GCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSD
FGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKIPYE
RFTNSETAEHIAQGLRLYRPHLASDRVYTIMYSCWHEKADERPSFKILLSNILDVMDEES
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggctgctgtgatactggagagcatctttctgaagcgctcccagcagaaaaagaaaaca
tcacctttaaattttaagaagcgcctatttctcctgactgtgcacaaactttcatactat
gaatatgactttgaacgtgggagaagaggcagtaagaaaggttcaatagatgtcgagaag
atcacctgtgttgaaacagtagttcctgaaaaaaatcccccaccagaaagacagattcca
gttccgaggggtgaggagtccagtgaaatggaacagatttcaatcattgaaaggttcccg
tacccatttcaggtcgtatatgatgaaggacctctctatgttttctccccaaccgaagag
ctgagaaaacgctggattcaccagctcaaaaatgtaatccggtacaatagtgacctggtg
cagaaatatcatccttgcttctggattgatggacagtatctctgctgctctcagacagcc
aagaatgctatgggctgccaaattttggagaacaggaatggaagcttaaaacctggaagt
tctcatcgaaaaacaaaaaagcctcttccccctaccccagaggaagatcagatcttgaaa
aagccactcccccctgagccaacagcagcaccaatctccacaagtgagctgaaaaaggtc
gtggccctttatgattatatgccaatgaatgcaaatgacttacaattgcgaaagggcgag
gagtattttatcctggaggagagcaacctaccatggtggcgagcacgagataaaaatggg
caggaaggctatatccccagtaactatgtcaccgaagcagaggactccatagagatgtat
gagtggtattccaagcacatgactcgaagtcaagctgagcaacttctaaagcaagagggg
aaagaaggaggtttcattgtcagagactccagcaaagctggaaaatacactgtgtctgtg
tttgctaaatctacaggggagcctcaaggggtgatacgccattatgttgtgtgctccaca
cctcagagccagtattacctggctgagaagcaccttttcagcaccattcctgagctcatc
aactaccatcaacataactctgcaggcctcatatccaggctgaaatatcctgtatcgaaa
caaaacaaaaacgcgccttctacggcaggcctgggctatggatcatgggaaattgatcca
aaggacttgaccttcttgaaggagcttgggactggacaatttggtgtcgtcaaatatggg
aagtggaggggccaatatgatgtggccatcaagatgatcagagaaggttccatgtctgag
gatgaattcattgaagaagccaaagtcatgatgaatctttcccatgagaagctagtgcag
ttgtatggagtctgcaccaaacagcgccccatcttcatcatcactgaatacatggctaat
ggctgcctcttgaactacctgagggagatgcggcaccgcttccagacacagcagctgctt
gagatgtgcaaagatgtctgtgaagcaatggaatacttggagtcaaagcagttccttcat
agagacctggcagctcgaaactgtctggtaaatgatcaaggagttgtgaaagtatctgac
tttggcctgtctaggtatgttcttgatgatgaatacaccagctcggtaggctccaaattt
ccagtccggtggtctccaccagaagtgctcatgtatagcaaattcagcagcaaatctgac
atctgggcttttggggttctaatgtgggaaatttactccctggggaaaataccatatgag
agatttactaacagtgagacagcagaacacattgctcaaggcttacgtctctacaggcct
catttggcatcagacagggtatataccatcatgtacagctgctggcatgagaaagcagat
gaacgtcctagtttcaaaattctcttgagtaacattctagatgtcatggatgaagaatct
tga

DBGET integrated database retrieval system