KEGG   Rattus norvegicus (rat): 406165
Entry
406165            CDS       T01003                                 

Gene name
Agpat1
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 1
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
rno04072  Phospholipase D signaling pathway
rno04975  Fat digestion and absorption
Module
rno_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    406165 (Agpat1)
   00564 Glycerophospholipid metabolism
    406165 (Agpat1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    406165 (Agpat1)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    406165 (Agpat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    406165 (Agpat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     406165 (Agpat1)
Lipid biosynthesis proteins [BR:rno01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   406165 (Agpat1)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 406165
NCBI-ProteinID: NP_997623
RGD: 1303287
Ensembl: ENSRNOG00000000437
Vega: OTTRNOG00000001706
UniProt: Q6MG85
Position
20p12
AA seq 284 aa
MELWPGAWTALLLLLLLLLSTLWFCSSSAKYFFKMAFYNGWILFLAILAIPVCAVRGRNV
ENMKILRLLLLHVKYLYGIRVEVRGAQHFPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVP
IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNH
NGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGRCQVRVLPPVPTEGLT
PDDVPALADRVRHSMLTIFREISTDGLGGGDCLKKPGGAGEARL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggagctgtggcccggggcctggacggcgctgctgctgctgctcctcctcctgctgtcc
accctgtggttctgcagctccagtgccaagtatttcttcaagatggccttctacaatggt
tggatcctcttcctggcaatactcgcgatccctgtgtgcgccgttcgaggacgcaatgtc
gagaacatgaagatcttgcgtctgctgctgctccacgtcaaatacttgtatgggatccga
gtggaggtgcggggggctcagcacttccctcccacacagccctacgttgttgtctccaac
caccagagttccctcgacctgcttggaatgatggaggtactgccagatcgctgtgtgccc
attgccaagcgtgaactattatgggctggctctgccgggctggcctgctggctggcagga
gtcatcttcattgaccggaaacgcacaggagacgctatcagtgtcatgtccgaggtggcc
cagaccctgctcacccaggatgtgagagtctgggtttttcctgaaggaacaagaaaccac
aatggctccatgctgcccttcaaacgaggcgccttccaccttgcagtacaggcccaggtc
cccatcgtccccattgtcatgtcctcctatcaagacttctactgcaaaaaggaacgccgc
ttcacctctgggcgatgtcaggtccgggtgctgcccccagtgcccacagaagggctcaca
ccagatgatgtcccagctctggcagacagagtccggcactccatgctcaccatcttccgg
gagatctccactgatggcctgggtggtggcgattgtctaaagaagcctgggggagcgggc
gaggcccggctctga

DBGET integrated database retrieval system