KEGG   Rattus norvegicus (rat): 407764
Entry
407764            CDS       T01003                                 

Gene name
St6galnac4
Definition
(RefSeq) alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform X1
  KO
K03374  N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7D) [EC:2.4.99.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    407764 (St6galnac4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    407764 (St6galnac4)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.7  alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3-N-acetylgalactosaminide 6-alpha-sialyltransferase
     407764 (St6galnac4)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   407764 (St6galnac4)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 407764
NCBI-ProteinID: XP_006234074
RGD: 1303005
Ensembl: ENSRNOG00000048870
Position
3
AA seq 470 aa
MEKLQSPRPVVITGVAQTFWRSLLVFPTTTQGLEWEAKLDRPRPQRRDLAPSPEVSETAT
HRSPPLRRPRLLSAKPPPLSEAPPTPPAELLQLPGFRSCGRRTASYPGPDSGPSGQAHWT
WSSDQRILSPRRTPTCSLVSLIFWDQLRAFLIPSSGDSSLQTAECRDSMKARGRLLLLIL
CSLTLSALYVFLCCWACLPLCLATCLDPHLPAPPRSTVPGPLHFRGYSSVPDGKPLTREL
CHSCAVVSSSGQMLGSGLGAQIDGAECVLRMNQAPTVGFEEDVGQRSTLRVISHTSVPLL
LRNYSHYFQHARDTLYVVWGQGRHMDRMLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYC
DQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCSEKSPRSVPYHYF
EKGRLDECQMYRLHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWKAK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggagaaactccagtctccacgaccggtagtcattacaggggtggctcaaaccttctgg
agatctcttctagtcttccctacaaccacacaaggactagagtgggaagctaaactagac
aggccccgccctcaacgtcgagacctcgcccccagcccggaggtctctgagacagccacg
caccgctcgccgccactgcgcaggccccgcctcctgagcgcaaagcctccgcccctctcg
gaggcccctcccacgcccccggcggagctgctccagcttccaggcttcagaagctgcggc
cgcaggaccgcctcctacccggggccggattccggcccctctggccaggcccactggaca
tggagctccgaccagcgcatcctgagcccccggcgcactccaacctgctcgttagtttcc
ctcatattctgggaccagcttcgagcctttctcatcccaagctctggagacagcagcctc
cagactgctgagtgcagagacagcatgaaggcccggggccgccttctgctcctcatacta
tgctccctgacactctccgctctctatgtcttcctgtgttgctgggcctgcctgcccctc
tgcctggcaacctgcctggacccccacctccctgcgccccccagatccactgtgccaggg
cccctgcacttcaggggctacagcagcgtgccagatgggaagccgcttacccgagaactg
tgccacagctgtgcggtggtgtccagctctggccagatgctgggttcgggcctgggtgct
cagatcgatggtgcggagtgcgtgctccgcatgaaccaggcacccactgtgggctttgag
gaggacgtgggccagcgcagcactctgcgcgtgatctcgcacacgagtgtgccgttactg
ctgcgtaactactcacactatttccagcatgcccgagacacgctctacgtggtgtggggc
cagggcaggcacatggaccggatgctgggcggccgcacctaccgcacattgcttcagctc
accagaatgtacccaggcctgcaagtgtacaccttcactgagcgcatgatggcctactgc
gaccagatcttccaagatgagacgggcaagaaccggagacaatcaggctccttccttagc
accggttggttcaccatgattctggccctggagctgtgcgaggagatcgtggtctacggg
atggtcagtgatagctactgcagtgagaagagtcctcgctccgtgccctaccactacttt
gagaagggcaggctggatgagtgtcagatgtaccgtttgcacgagcaggctccgaggagc
gcccatcgctttatcaccgagaaggctgtgttctcccgctgggccaagaagcggcccatc
gtgttcgcccacccgtcctggaaggccaagtag

DBGET integrated database retrieval system