KEGG   Rattus norvegicus (rat): 497672
Entry
497672            CDS       T01003                                 

Gene name
Brca1
Definition
(RefSeq) breast cancer type 1 susceptibility protein homolog
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03440  Homologous recombination
rno03460  Fanconi anemia pathway
rno04120  Ubiquitin mediated proteolysis
rno04151  PI3K-Akt signaling pathway
rno05206  MicroRNAs in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    497672 (Brca1)
  09124 Replication and repair
   03440 Homologous recombination
    497672 (Brca1)
   03460 Fanconi anemia pathway
    497672 (Brca1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    497672 (Brca1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    497672 (Brca1)
  09162 Cancer: specific types
   05224 Breast cancer
    497672 (Brca1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    497672 (Brca1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    497672 (Brca1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    497672 (Brca1)
   03036 Chromosome and associated proteins [BR:rno03036]
    497672 (Brca1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    497672 (Brca1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     497672 (Brca1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     497672 (Brca1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    497672 (Brca1)
  Multi subunit Ring-finger type E3
   BRCC complex
    497672 (Brca1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     497672 (Brca1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     497672 (Brca1)
    BRCA1-A complex
     497672 (Brca1)
    BRCA1-B complex
     497672 (Brca1)
    BRCA1-C complex
     497672 (Brca1)
    BRCA complex
     497672 (Brca1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     497672 (Brca1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 BRCT_2 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-RING_6 zf-Nse zf-ANAPC11 Prok-RING_4 zf-RING_10 zf-rbx1
Other DBs
NCBI-GeneID: 497672
NCBI-ProteinID: NP_036646
RGD: 2218
Ensembl: ENSRNOG00000020701
UniProt: O54952
Structure
PDB: 
1L0B

Position
10
AA seq 1817 aa
MDLSAVRIQEVQNVLHAMQKILECPICLELIKEPVSTQCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNEITKRSLQGSARFSQLVEELLKIIDAFELDTGMQCANGFSFSKKKNSSSELLNE
DASIIQSVGYRNRVKKLQQIESGSATLKDSLSVQLSNLGIVRSMKKNRQTQPQNKSVYIA
LESDSSEERVNAPDGCSVRDQELFQIAPGGAGDEGKLNSAKKAACDFSEGIRNIEHHQCS
DKDLNPTENHATERHPEKCPRISVANVHVEPCGTDARASSLQRGTRSLLFTEDRLDAEKA
EFCDRSKQSGAAVSQQSRWADSKETCNGRPVPRTEGKADPNVDSLCGRKQWNHPKSLCPE
NSGATTDVPWITLNSSIQKVNEWFSRTGEMLTSDNASDRRPASNAEAAVVLEVSNEVDGC
FSSSKKIDLVAPDPDNAVMCTSGRDFSKPVENIINDKIFGKTYQRKGSRPHLNHVTEIIG
TFTTEPQIIQEQPFTNKLKRKRSTCLHPEDFIKKADLTVVQRISENLNQGTDQMEPNDQA
MSITSNGQENRATGNDLQRGRNAHPIESLRKEPAFTAKAKSISNSISDLEVELNVHSSKA
PKKNRLRRKSTRCVLPLEPISRNPSPPTCAELQIESCGSSEETKKNNSNQTPAGHIREPQ
LIEDTEPAADAKKNEPNEHIRKRSASDAFPEEKLMNKAGLLTSCSSPRKPQGPVNPSPER
KGIEQLEMCQMPDNNKELGDLVLGGEPSGKPTEPSEESTSVSLVPDTDYDTQNSVSILEA
NTVRYARTGSVQCMTQFVASENPKELVHGSNNAGSGSECFKHPLRHELNHNQETIEMEDS
ELDTQYLQNTFQVSKRQSFALFSKLRSPQKDCTLVGARSVPSREPSPKVTSRGEQKERQG
QEESEISHVQAVTVTVGLPVPCQEGKPGAVTMCADVSRLCPSSHYRSCENGLNTTDKSGI
SQNSHFRQSVSPLRSSIKTDNRKTLTEGRFEKHTERGMGNETAVQSTIHTISLNNRGDAC
LEASSGSVIEVHSTGENVQGQLDRNRGPKVNTVSLLDSTQPGVSKQSAPVSDKYLEIKQE
SKAVSADFSPCLFSDHLEKPMRSDKTFQVCSETPDDLLDDVEIQENASFGEGGITEKSAI
FNGSVLRRESSRSPSPVTHASKSRSLHRGSRKLEFSEESDSTEDEDLPCFQHLLSRVSST
PELTRCSSVVTQRVPEKAKGTQAPRKSSISDCNNEVILGEASQEYQFSEDAKCSGSMFSS
QHSAALGSPANALSQDPDFNPPSKQRRHQAENEEAFLSDKELISDHEDMAACLEEASDQE
EDSIIPDSVASGYESEANLSEDCSQSDILTTQQRATMKDNLIKLQQEMAQLEAVLEQHGS
QPSGHPPCLPADPCALEDLPDPEQNRSGTAILTSKNINENPVSQNPKRACDDKSQPQPPD
GLPSGDKESGMRRPSPFKSPLTSSRCSARGHSRSLQNRNSTSQEELLQPAXLEKSCEPHN
LTGRSCLPRQDLEGTPYPESGIRLVSSRDPDSESPKVSALVCTAPASTSALKISQGQVAG
SCRSPAAGGADTAVVEIVSKIKPEVTSPKERAERDISMVVSGLTPKEVMIVQKFAEKYRL
ALTDVITEETTHVIIKTDAEFVCERTLKYFLGIAGGKWIVSYSWVIKSIQERKLLSVHEF
EVKGDVVTGSNHQGPRRSRESQEKLFEGLQIYCCEPFTNMPKDELERMLQLCGASVVKEL
PLLTRDTGAHPIVLVQPSAWTEDNDCPDIGQLCKGRLVMWDWVLDSISVYRCRDLDAYLV
QNITCGRDGSEPQDSND
NT seq 5454 nt   +upstreamnt  +downstreamnt
atggatttatctgctgttcgaattcaagaagtacaaaatgtccttcatgctatgcagaaa
atcttggagtgtccaatctgtttggaactgatcaaagaaccggtttccacacagtgcgac
cacatattttgcaaattttgtatgctgaaactccttaaccagaagaaaggaccttcccag
tgtcctttgtgtaagaatgagataaccaaaaggagcctacaaggaagtgcaaggtttagt
caacttgttgaagagctgctgaaaatcattgatgcttttgagcttgacaccggaatgcag
tgtgcaaatggttttagtttttcaaaaaagaaaaatagttcttctgagcttctgaatgag
gacgcttctatcatccagagtgtgggctaccgaaaccgcgtcaaaaaacttcaacagatt
gagtctggaagtgccaccttgaaggacagtctcagtgtccagttgtctaaccttgggatt
gtgagatcaatgaagaaaaataggcagacacaacctcaaaacaaatctgtctacattgct
ttagaatctgattcttctgaggagagagtaaatgcacccgatggctgcagtgtgagagat
caggaattgtttcagatcgcccctggaggagctggagatgaaggcaagttgaactctgca
aaaaaggctgcttgtgacttttctgagggcataagaaacattgaacatcatcaatgcagt
gataaagatttgaaccccactgagaatcatgcaactgaaaggcatccagaaaaatgtccg
cgtatttctgttgcaaacgtgcacgtggagccgtgtggcacagatgctcgtgccagctca
ttacagcgtgggacccgcagtttattgttcactgaggacagactggatgcagaaaaggct
gaattctgtgatagaagcaaacagtctggcgcagcagtgagccagcagagcagatgggct
gacagtaaagaaacatgtaatggcaggccggttccccgcactgagggaaaggcagatcca
aatgtggattccctctgtggtagaaagcagtggaatcatccgaaaagcctgtgccctgag
aattctggagctaccactgacgttccttggataacactgaatagcagcattcagaaagtg
aatgagtggttttccagaactggtgaaatgttaacttctgacaatgcatctgacaggagg
cctgcgtcaaatgcagaagctgctgttgtgttagaagtttcaaatgaagtggatggatgt
ttcagttcttcaaagaaaatagacttagttgcccctgatcccgataatgctgtaatgtgt
acaagtggaagagacttctccaagccagtagagaatattatcaacgataaaatatttggg
aaaacctatcagagaaagggaagccgccctcacttgaaccatgtgactgaaattataggc
acatttactacagaaccacagattatacaagagcagcccttcacaaataaattaaaacgc
aaaagaagtacatgccttcatcctgaggactttatcaagaaagcagatttaacagttgtt
caaaggatttctgaaaatttaaatcagggaactgaccaaatggagccaaatgaccaagca
atgagtattaccagtaacggtcaggagaacagagcaacaggtaatgatcttcagagaggg
agaaatgctcatccaatagaatcattgagaaaggaacctgctttcacagctaaagccaaa
tctataagcaacagtataagtgatttggaggtagaattaaatgttcacagttcaaaagca
cctaagaaaaataggctgaggaggaagtctaccaggtgtgttcttccactcgaaccaatc
agtagaaatccgagcccacctacttgtgctgaacttcagatcgagagttgtggtagcagt
gaagaaacaaagaaaaacaattccaaccaaaccccagccgggcacattagagagcctcaa
ctcatcgaagacacagaacccgcagctgatgccaagaagaacgagccaaatgaacacata
aggaagagaagtgccagtgatgcgttcccagaagagaaattaatgaacaaagctggttta
ttaactagctgttcaagtcctagaaagcctcaaggacctgtcaatcctagccctgagaga
aaaggaatagagcaacttgaaatgtgccagatgcctgataataacaaagaactcggggat
ttggtcctgggaggagagcccagtgggaaacctactgaaccatctgaggagagcaccagt
gtgtccttggtacccgacacagactacgacacccagaacagtgtctcaatactggaagcg
aacactgtcagatatgcaagaacaggatcagttcagtgtatgactcagtttgtcgcaagt
gaaaaccccaaggaacttgtccatggttctaacaatgctggaagtggctcggagtgcttc
aagcacccattgagacatgaacttaaccacaatcaagagacaatagaaatggaagacagt
gaacttgatactcagtatttgcagaatacatttcaagtttcaaagcgtcagtcatttgct
ttattttcaaaacttagaagtccccaaaaggactgtactctggtaggtgcccgctctgtg
ccctcaagggaaccaagtccaaaggtgacttctagaggtgaacaaaaagaacgtcaggga
caagaagagtctgaaatcagtcatgtacaggcagtcacagtcacagtaggcttacctgtg
ccctgtcaggaaggtaagccaggtgctgttacaatgtgtgctgatgtttctaggctttgt
ccgtcatctcattatagaagctgtgagaatggactcaacaccacagataaatctggaatt
tcacaaaactcacattttagacaatcagtttctcccctcaggtcatctataaaaactgac
aatagaaaaactctgacagagggncgatttgagaaacatactgaaaggggratgggaaat
gagactgctgttcaaagtacaatacacacaattagtctaaataacagaggagatgcttgt
ctagaagccagctcaggcagtgttattgaagtacattccactggtgaaaacgtccagggg
caactagatagaaacagagggcctaaggtaaacaccgtgtctctattagatagtacacag
cctggtgtctctaagcagagtgctcctgtaagtgataagtatcttgaaataaagcaggag
agtaaggctgtcagtgcagacttctctccatgtctgttctcagatcatcttgaaaaacct
atgagaagtgataagacttttcaggtttgctctgagacacctgatgacctgttggatgat
gttgaaatacaggaaaatgctagcttcggtgaaggtggcataacggaaaagtctgctatt
tttaatggaagtgtcctgagaagagagtccagtaggagccctagccctgtaacccatgca
tcgaagtcgcggagtctccacagagggtctaggaaattagaattctcagaagagagcgac
tccactgaggatgaagaccttccctgcttccaacacttgctgagcagagtaagcagcaca
cccgaacttaccagatgcagcagtgtggtgacacagcgtgtgccagagaaagcgaagggg
acccaagcaccccggaagagtagcatcagtgactgcaataatgaggtgatcttgggagag
gcatctcaggaatatcagtttagtgaggatgcaaaatgctctggcagcatgttctcctca
cagcacagtgctgccctaggttcncctgcaaatgcactctcccaggatcccgattttaat
ccaccttccaaacaaaggcgtcaccaggctgagaatgaggaagcctttctaagtgataag
gaattgatttcagatcatgaggacatggcagcttgcctggaagaggctagcgatcaagaa
gaggacagtataatcccggactcagtggcgtctggatatgagagtgaagcaaacctctct
gaagactgctcacagagtgatattctaaccactcagcagagggcgaccatgaaggataac
ctgataaagctccagcaggaaatggctcagctggaagctgtgctagagcagcatgggagc
cagccgtctggccaccccccttgcctcccagctgacccttgtgccctagaagacctgcca
gatccagaacaaaacagatcaggaacagcaattttaacttcaaagaacattaatgagaat
cctgtaagccagaatccaaagcgcgcctgtgatgacaaatcccaaccacaacctccggac
ggtctccccagtggagataaggagtcaggaatgagaaggccttccccttttaaatctcca
ctgaccagcagtaggtgctctgcacgaggccactccaggagtcttcagaatagaaactcc
acstcgcaagaggagctccttcagcctgctgrattggagaagtcatgtgaaccacacaac
ttaacagggcggtcttgcttgccaaggcaagatctcgaaggaaccccatacccggaatct
ggaatcaggctagtctccagcagagaccctgattctgaatcccctaaagtgtcagccctt
gtttgcactgcaccagcttcaacctctgcactgaaaatatcccaaggtcaagttgctggg
tcttgcaggagtccagctgctggtggtgctgatactgcagtggtagaaattgtgagcaag
ataaagccggaagtgacgtctccaaaagaacgagcggagagagatatatccatggtggtg
tcaggcttgacccctaaagaagtaatgattgtccaaaagtttgctgaaaaataccgcctt
gctttaactgatgtaattactgaggaaactacgcatgtaattataaaaacagatgctgag
tttgtgtgtgaacggacactgaaatattttctgggcattgcaggaggaaagtggatagtt
agctattcttgggtgatcaagtctatccaagaaagaaaacttctgagtgtgcatgaattt
gaagtcaaaggagacgttgtgactggaagcaaccaccaaggtccaaggcgatccagagaa
tcccaggaaaagctctttgaaggcctacagatctattgttgtgagcccttcaccaacatg
cccaaagatgagctggagaggatgctgcagctgtgtggggcttctgtggtgaaggagctt
ccattgctcacccgtgacacaggtgctcatccaattgtgctcgtgcagccaagtgcctgg
acagaagacaacgactgccctgatattgggcagctgtgcaagggacgtctagtgatgtgg
gactgggtgttggacagtatatccgtctaccggtgtcgggatctggatgcctacctggta
cagaatatcacctgtggccgtgatggtagcgagccacaagactccaatgattaa

DBGET integrated database retrieval system