KEGG   Rattus norvegicus (rat): 497770
Entry
497770            CDS       T01003                                 

Gene name
Scn3a
Definition
(RefSeq) sodium channel protein type 3 subunit alpha
  KO
K04836  voltage-gated sodium channel type III alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    497770 (Scn3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    497770 (Scn3a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   497770 (Scn3a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel GPHH ATP-synt_B SieB IQ
Other DBs
NCBI-GeneID: 497770
NCBI-ProteinID: NP_037251
RGD: 3635
Ensembl: ENSRNOG00000005007
UniProt: P08104
Structure
PDB: 
1BYY

Position
3
AA seq 1951 aa
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDIDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYVSKKTFVVLNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIADDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNHRADGDRFPKSESEDSVKRRSFLLS
LDGNPLTGDKKLCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRPGERRNSNGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAMSIA
SILTNTMEELEESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITIC
IVLNTLFMAMEHYPMTQQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDG
IIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVL
AIIVFIFAVVGMQLFGKSYKECVCKINVDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMW
DCMEVAGQTMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVG
RMQKGIDFVKNKIRECFRKAFFRKPKVIEIQEGNKIDSCMSNNTGIEISKELNYLKDGNG
TTSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEES
KEKLNATSSSEGSTVDVAPPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKG
KIWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTY
IFILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRAL
RPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTT
GNMFEIKEVNNFSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDS
RDVKLQPIYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDD
QSKYMTLVLSRINLVFIVLFTGEFLLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAEL
IEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIY
AIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPD
AIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDD
FEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHC
LDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAAIIQR
NYRCYLLKQRLKNISSKYDKETIKGRIDLPIKGDMVIDKLNGNSTPEKTDGSSSTTSPPS
YDSVTKPDKEKFEKDKPEKEIKGKEVRENQK
NT seq 5856 nt   +upstreamnt  +downstreamnt
atggcccaggcactgctggtacccccgggacctgagagcttccgccttttcactcgagaa
tctcttgctgctatcgaaaagcgtgctgcagaagagaaagccaagaaacccaagaaagag
caagacattgacgatgagaacaaaccaaagccaaacagcgacttggaagctgggaagaac
cttccatttatctatggagacattcctccagagatggtgtcggagcccctggaggacctg
gacccctactatgtcagtaagaaaacttttgtagtgttgaataaagggaaggcgattttt
cgattcagcgccacctccgccctgtatattttaactccgctaaaccctgttaggaaaatt
gccattaagattttggtacactctttgttcagcatgcttatcatgtgcactattttgacc
aactgtgtatttatgacgttgagtaatcctcccgactggacaaagaatgtagagtatacg
ttcactgggatctatacctttgagtcacttataaagatcttggcaagagggttttgctta
gaagatttcactttcctccgtgacccatggaactggctggatttcagtgtcatcgtgatg
gcatatgtgacagagtttgtggacctgggcaatgtctcagcgctgagaacgttcagagtt
ctccgagcattgaaaacaatatcagtcattccaggtttaaagaccatcgtgggggccctg
atccagtccgtgaagaagctgtccgacgtcatgatcctcaccgtgttctgtctcagtgtc
tttgctctaatcgggctgcagctcttcatgggcaacctgaggaataaatgcttgcagtgg
cccccgagcgattcggcttttgaaaccaacactacttcctacttcaatggcacaatggat
tcaaatgggacatttgttaatgtaacaatgagcactttcaactggaaggattatatcgca
gatgacagtcacttttatgtcttggatggacaaaaagatcctttactctgtggaaatggc
tccgatgcaggacaatgtccagaagggtacatctgtgtgaaggctggacgaaaccccaac
tacggctacacaagctttgacaccttcagctgggccttcttgtccctgtttcgactcatg
actcaggactactgggagaatctttaccagttgacattgcgtgcagctgggaaaacctac
atgatatttttcgtcctggtaattttcttgggctcgttttatttggtgaacttgatcctg
gctgtggtggccatggcctatgaggagcagaaccaggccacactggaggaggctgaacag
aaggaggcagagtttcagcagatgctggagcaactgaagaagcagcaggaggaggctcag
gcagtggctgcagcctccgcggcatccagagacttcagtggaataggagggttaggagaa
cttctggagagttcttcagaagcttccaagttgagctccaagagtgctaaggagtggagg
aaccggaggaagaagaggagacagagggaacacttggagggaaaccacagagccgatgga
gacaggtttcccaagtcggaatcggaagacagtgtcaaacgaagaagcttcctgctctcc
ctggatggcaacccgctgactggtgacaagaagctgtgctctccccaccagtctctcttg
agtatccgtggctccctgttttccccaagacgcaatagcaaaacgagcattttcagcttc
agaggtcgggcgaaggacgtggggtctgagaatgactttgcagacgatgagcacagcacc
ttcgaggacagcgagagcaggagagactccctgtttgtgccgcacagacctggagagcga
cgcaacagtaacggtaccaccactgaaacggaagtcaggaagagaaggctaagttcttac
cagatttcgatggaaatgctggaggattcctctggaagacaaagagccatgagcatagcc
agtatcctgaccaacaccatggaggaacttgaagaatctagacagaagtgcccaccatgc
tggtatagattcgccaatgtgtttttgatctgggactgctgtgatgcatggttaaaagtg
aagcatcttgtgaatttaattgtgatggatccatttgttgatcttgccataacaatttgc
atcgtattaaatacactgttcatggccatggagcactatcccatgacccagcagttcagc
agtgtgctgactgtgggaaacctggtcttcactgggatcttcacagccgaaatggtcctt
aaaatcattgccatggacccctattattatttccaagagggctggaatattttcgatgga
attattgttagcctgagtttaatggagctaggcctggcaaatgtggaggggctgtctgtg
cttcggtccttcagactgctccgagtcttcaagttggcaaagtcctggcccacactgaac
atgctcattaagatcatcggcaactcggtgggcgcactgggcaacctgaccctggtgctg
gccatcatcgtcttcatttttgccgtggtcggcatgcagctgtttggaaagagctacaag
gagtgtgtctgcaagatcaatgtggactgcaagctgccgcgctggcacatgaacgacttc
ttccactccttcctgatcgtgttccgagtgctgtgtggggagtggatagagaccatgtgg
gactgcatggaggtcgcgggccagaccatgtgccttattgtgttcatgttggtcatggtg
attgggaaccttgtggttctgaacctctttctggccttattgttgagttcctttagttca
gataaccttgctgctactgacgatgataacgaaatgaacaacctccagatcgcggtggga
aggatgcaaaagggaattgattttgtgaaaaataagatacgggagtgcttccgaaaagcg
tttttcagaaagccgaaagtgatagaaatccaagaaggcaacaaaatagacagctgcatg
tccaataacacgggcatcgaaataagcaaagagcttaactaccttaaagacggtaatgga
accaccagcggcgtgggaaccggaagcagtgtggaaaaatacgtaatcgatgaaaatgac
tacatgtcattcataaacaatcccagcctcaccgtgactgtgccaattgctgtgggagag
tctgactttgaaaatttaaatacggaagagttcagcagtgagtcagaattggaagaaagt
aaggagaaattaaatgcaaccagctcttctgaaggaagcacagttgatgttgctccaccc
cgagaaggtgaacaagcagaaattgaacctgaggaggaccttaagccagaagcttgtttt
actgaagggtgcattaaaaaattccccttctgtcaagtaagtacagaagaaggtaaagga
aaaatatggtggaatcttaggaagacatgctacagcattgtggagcacaactggtttgaa
acgttcattgtgttcatgattctcctcagtagtggcgctttggcctttgaggatatatac
attgagcaacgaaagacgatcaagaccatgctggagtatgcagacaaggtcttcacgtac
atcttcatcctggagatgctcctcaaatgggtggcctatggatttcaaacctatttcacc
aatgcctggtgctggttggacttcctgatcgttgatgtttctttggttagcctggtagcc
aatgctcttggttactcagaacttggtgccatcaaatccctacggacactgagagctctg
aggccactccgagccttatcccgctttgaaggcatgagggtggttgtgaatgctcttgtt
ggtgcaattccctccatcatgaatgtgttattggtgtgtctcatcttctggctgattttt
agcatcatgggtgtgaatctgtttgctggaaagttctatcactgtgttaacacgacaaca
ggcaacatgtttgaaataaaagaagtgaacaatttcagtgactgtcaggctcttggcaag
caagcccggtggaagaatgtgaaagtcaactttgacaacgttggggctggctacctggca
ttgctgcaagtggccacattcaaaggctggatggacatcatgtatgcagctgttgattcg
cgggacgtcaaactgcagcccatatatgaagaaaacctgtacatgtacctgtactttgtc
atcttcatcatcttcggctcgttcttcactctaaatctattcatcggtgtcatcatagac
aacttcaaccagcagaagaagaagtttggaggtcaagacatctttatgacagaagaacag
aagaaatactacaatgcaatgaagaagctcggctcaaagaaacctcagaagcccatccct
cggcctgcaaacaaatttcaagggatggtctttgattttgtaaccagacaagtgtttgac
atcagcatcatgatcctcatctgcctcaacatggtgaccatgatggtggaaacggatgac
cagagcaaatacatgaccctggttttgtcccgaatcaacctagtgttcattgtcctcttc
actggggagtttctgctgaagctcatctccctcagatactactacttcacgatagggtgg
aacatctttgactttgtggtggtgattctctcgattgtaggaatgtttctcgcggagctg
atagagaagtatttcgtgtcccctaccctgttccgagtcatccgcctggccaggattgga
cgaatcctacgcctgatcaaaggcgccaaggggatccgcactctgctctttgctttgatg
atgtcccttcctgcgctgttcaacatcggcctcctgcttttcctggtcatgttcatctac
gccatctttgggatgtccaactttgcctacgttaaaaaagaggctggaattgatgacatg
ttcaactttgagacttttggcaacagcatgatctgcttgttccaaatcaccacctctgcc
ggctgggacggactgctggcccccatcctcaacagcgcacctcccgactgtgaccccgat
gcaattcaccctggaagctcggtgaagggggactgtgggaacccatccgtggggattttc
ttttttgtcagctacatcatcatatccttcctggtggtggtgaacatgtacatcgctgtc
atcctggagaacttcagcgtcgccaccgaagaaagtgcagagcccctgagtgaggacgac
tttgagatgttctacgaggtctgggagaagttcgaccctgacgccactcagttcatagag
ttctgcaagctctctgactttgcagctgccctggatcctcccctcctcatcgcaaagcca
aacaaagtccagctcattgccatggacctgcccatggtgagtggagaccgcatccactgc
ctggacatcttgtttgcttttacaaagcgggtcctgggcgagagtggagagatggacgct
cttcgaatccagatggaagaaaggttcatggcttccaacccctccaaggtctcttatgag
cccattaccaccaccctgaaacggaaacaagaggaggtgtctgctgctatcattcagcgt
aattatagatgttatcttttaaagcaacggttaaaaaacatatcgagtaaatacgacaaa
gagacaatcaagggaaggattgacttgcctataaaaggagatatggttattgacaaattg
aatgggaattccaccccagaaaagacggatgggagttcctccacaacctctcctccttcc
tatgacagtgtaacaaaaccagataaggaaaagtttgagaaagacaaaccagaaaaagaa
atcaaagggaaagaggtccgagagaatcaaaagtaa

DBGET integrated database retrieval system