KEGG   Rattus norvegicus (rat): 497811Help
Entry
497811            CDS       T01003                                 

Gene name
Xdh, XOR
Definition
(RefSeq) xanthine dehydrogenase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00232  Caffeine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    497811 (Xdh)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    497811 (Xdh)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    497811 (Xdh)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    497811 (Xdh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    497811 (Xdh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     497811 (Xdh)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     497811 (Xdh)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   497811 (Xdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Motif
Other DBs
NCBI-GeneID: 497811
NCBI-ProteinID: NP_058850
RGD: 62043
Ensembl: ENSRNOG00000007081
UniProt: P22985
Structure
PDB: 

Position
6q13-q14
AA seq 1331 aa AA seqDB search
MTADELVFFVNGKKVVEKNADPETTLLVYLRRKLGLCGTKLGCGEGGCGACTVMISKYDR
LQNKIVHFSVNACLAPICSLHHVAVTTVEGIGNTQKLHPVQERIARSHGSQCGFCTPGIV
MSMYTLLRNQPEPTVEEIENAFQGNLCRCTGYRPILQGFRTFAKDGGCCGGSGNNPNCCM
NQTKDQTVSLSPSLFNPEDFKPLDPTQEPIFPPELLRLKDTPQKKLRFEGERVTWIQAST
MEELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPLIVCPAWIPELNSVVHGPEGISFGA
SCPLSLVESVLAEEIAKLPEQKTEVFRGVMEQLRWFAGKQVKSVASIGGNIITASPISDL
NPVFMASGAKLTLVSRGTRRTVRMDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAF
KQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTISALKTTPKQLSKSWNEE
LLQSVCAGLAEELQLAPDAPGGMVEFRRTLTLSFFFKFYLTVLQKLGRADLEDMCGKLDP
TFASATLLFQKDPPANVQLFQEVPKDQSEEDMVGRPLPHLAANMQASGEAVYCDDIPRYE
NELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAEDVPNSNATGLFNDETVFAKDEV
TCVGHIIGAVVADTPEHAQRAARGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGDLK
KGFSEADNVVSGELYIGGQEHFYLETNCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKML
GVPDNRIVVRVKRMGGGFGGKETRSTVVSTALALAAHKTGRPVRCMLDRDEDMLITGGRH
PFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFHMDNAYKIPNIRGTGRI
CKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGLPAEEVRRKNMYKEGDLTHFNQKLE
GFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCIIPTKFGISFTLPFLNQGGAL
VHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISETSTNTVPNTSPTAAS
ASADLNGQGVYEACQTILKRLEPFKKKKPTGPWEAWVMDAYTSAVSLSATGFYKTPNLGY
SFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFV
QGLGLFTMEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKRAIYASKAVG
EPPLFLASSIFFAIKDAIRAARAQHGDNAKQLFQLDSPATPEKIRNACVDQFTTLCVTGV
PENCKSWSVRI
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggatgagttggtcttctttgtgaatggcaaaaaggtggtggagaaaaatgcg
gaccctgaaacaacacttctggtctacctgagaagaaagttggggctatgtgggaccaag
cttggctgtggagaaggtggctgtggggcatgcaccgtgatgatctccaagtatgaccgt
cttcagaacaagattgttcatttttctgtcaatgcctgcttggctcccatctgctccttg
caccatgttgctgtgaccaccgtggaaggcataggaaacacccagaagctgcatcctgta
caggagagaattgccagaagccatggttcccagtgtgggttctgcactcctggcattgtc
atgagtatgtacacactgctccggaaccagcctgagcctactgttgaggagatcgagaat
gccttccaaggaaacctctgtcgctgtacaggctacagacccatcctccagggattccgg
acctttgccaaggatggtgggtgctgtggagggagtggaaacaacccaaactgctgtatg
aaccagacgaaagaccaaacggtttctctctcaccttctttattcaacccagaggatttc
aaacctttagatcccacgcaagagcccatcttccccccagagttgctgaggctgaaagac
actccccagaagaagctgcgttttgaaggggaacgtgtgacctggatccaggcttcaact
atggaggagctgcttgacctgaaagctcagcaccctgatgccaagctggtggtgggaaac
acagagataggcattgaaatgaaatttaagaatatgctatttcctctgatcgtctgccca
gcctggatccctgaactgaattcagtggtgcatgggcctgagggaatctccttcggagct
tcttgcccccttagcttggtggaaagtgtcctggcggaggagattgctaaacttccagag
caaaagacagaggtgttcagaggcgtgatggagcagctgcgctggtttgccggcaagcag
gtcaagtccgtggcgtccatcggagggaacatcatcactgccagccccatctctgacctc
aaccctgtgttcatggccagtggagccaagctgactctggtgtctagaggtaccaggaga
actgttcggatggatcataccttcttccctggctacagaaagactctgctcagaccagag
gagatattgctgtccatcgagatcccctatagcaaggagggagagtttttctcagccttc
aagcaggcctccaggagggaagatgacattgccaaggtgactagtggcatgagagtcctg
ttcaaaccggggaccattgaagtgcaggaactgtccctttgcttcggagggatggccgac
agaactatctcagccctcaagaccactccgaagcagctatcgaagtcctggaatgaggag
ctgctgcagagcgtgtgtgccggcttggcagaggagctgcagctggcccccgatgcccct
ggtggtatggtggaattccggcgcaccctcaccctcagcttcttcttcaagttctacctg
acagtgctccagaagctgggcagagcggaccttgaggatatgtgtggtaaactggacccc
acctttgccagtgccaccctgctctttcagaaggaccctccagctaatgtccagcttttc
caagaggtgccaaaggatcagtctgaggaggacatggtgggccggcccctgcctcacctg
gcggcaaacatgcaggcatcgggagaggccgtgtactgtgatgacattccccgctatgag
aatgagctctctctcaggctggtcaccagcacccgggcgcatgctaaaatcacgtccatc
gacacttcagaagccaagaaggtgccagggtttgtttgcttcctcaccgcagaggatgtc
cctaatagtaatgcaaccggccttttcaatgatgaaactgtctttgcgaaggatgaggtt
acttgtgttgggcacatcattggtgctgtggtcgctgacaccccagaacacgcacagaga
gctgcgagaggggtgaaaatcacctatgaagatcttccagccattatcacaatccaggat
gctataaacaacaactccttttatggctctgagataaaaattgagaaaggagatctcaag
aaaggcttttcagaagctgacaatgttgtctcaggagagttgtatatcggtggccaggag
cacttctacctggagaccaactgcaccattgccgtgccaaaaggcgaggcaggcgagatg
gagctgttcgtgagcacacagaacaccatgaaaacccagagctttgttgcaaaaatgttg
ggcgttccggacaacagaatcgtagtccgagtgaagaggatgggtggaggctttggaggg
aaggagacccggagcactgtggtgtccacagcactggccttggctgcacacaagactggc
cggcccgtacgttgcatgttggaccgagatgaggacatgctgataactggtggcagacat
cccttcctggctaaatacaaggttggcttcatgaagactgggactgtagtggctctcgag
gtggctcacttcagcaatggtggtaacactgaggatctctctcggagtataatggaacga
gctttgttccacatggataacgcctataagatccccaacattcgaggcactgggaggatt
tgcaagactaatctgccctccaacacagccttcagaggttttgggggtcctcaggggatg
ctaatcgcagaatactggatgagcgaggtcgccataacctgtgggctgcctgcagaggag
gtacggaggaaaaacatgtacaaagaaggggacctgactcacttcaaccagaagctggag
gggttcaccttgcccaggtgctgggatgaatgcatcgccagctctcagtatcttgctcgc
aagagggaagtggagaaattcaacagggagaattgttggaaaaagagagggctgtgtata
atcccaactaagtttggaataagctttacacttccttttctgaaccagggaggcgctctg
gttcacgtgtacactgatggttcggtgctgttgacccatggagggactgagatgggccaa
ggccttcacaccaagatggttcaggtggccagcagagctctgaaaatccccacctccaag
attcatataagtgagacaagcactaacaccgtccccaacacttctcccacagctgcctct
gccagtgctgacctcaatggacagggtgtttatgaagcatgccagaccatactgaaaagg
ctggaacctttcaagaagaagaaacccaccggcccctgggaggcatgggtgatggacgcc
tatacgagcgcagtgagtttgtccgcaactggattttataagacacccaaccttggctac
agctttgagacaaactccggaaatcccttccactatttcagttatggggtggcttgctct
gaagtagaaattgactgcttaacaggggatcataagaatctccgtacggatatcgtcatg
gatgttggttccagcttgaatcctgccattgatattggacaagtagagggggcatttgtc
cagggccttggtctcttcactatggaggagctgcactactcccctgaggggagcctgcat
actcgtggccccagtacctacaaaatccctgcatttggtagcatccccattgagttcaga
gtatccctactccgggactgccccaacaagagggccatctatgcatccaaggctgttggg
gagccacctcttttcctggcttcctctatcttctttgccatcaaagatgccattcgtgca
gctcgagctcagcacggagataacgcaaaacaacttttccagctagacagccctgccact
ccggagaagatccgaaacgcctgtgtggaccagttcaccaccctgtgtgtcactggagta
ccagaaaactgtaaatcctggtctgtgaggatctga

DBGET integrated database retrieval system