KEGG   Rattus norvegicus (rat): 498194
Entry
498194            CDS       T01003                                 

Gene name
Mn1, RGD1565571
Definition
(RefSeq) meningioma 1
  KO
K22543  transcriptional activator MN1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    498194 (Mn1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Others
    498194 (Mn1)
SSDB
Other DBs
NCBI-GeneID: 498194
NCBI-ProteinID: NP_001178857
RGD: 1565571
Ensembl: ENSRNOG00000027489
UniProt: D4AAP6
Position
12q16
AA seq 1304 aa
MFGLDQFEPQINSRHAGQGEGNFNEAGLSMNAHFKAPAFHAGPPPGPVDPAISALGEPPI
LGLNMEPYGFHARGHSELHAGGLQAQPVHGFFGGQQPHHSHPGGHHPHQHHPHFGGNFGG
PDPGASCLHGGRLLGYGGAASGLGSQPPFAESYEHMAESQGPEGFGPQRPGNLPDFHSSG
TSGHAVPAPCLPLDQSPNRAASFHGLSASSGSDSHSLEPRRVTNQGAVDSLEYNYPSEPP
SGHFDMFSPSDSEGQLPHYAAGRQVPGGAFPGASAMPRASGMVGLSKMHGQPPQPPPPQQ
QPQHGVFFERFGGARKMPVGLEPAVGSRHPLMQPPQQAPPPPQQQPQQQQPPPPPGLLVR
QNSCPPALPRPQQGEAGTPSGGLQDGGPMLPSQHAQFEYPIHRLENRSMHPYSEPVFSMQ
HPPPQQAPNQRLQHFDAPPYMNVAKRPRFDFPGSTGVDRCASWNGSMHNGTLDNQLSPSA
YPGLPGEFTPPVPDSFPSGPPLQHPGPDHQSLQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQRQNAALMIKQMASRNQHQRLRQPNLAQLGHPGDVGQGGLVHGGSVSGLAQTNFEREGG
STGAGRLGGFEQQAPHLAQESAWFPGPHPPGDLLPRRMGSAGLPADCGPHDPGLAPPPAP
GGSGVLFRGSLQEPLRMPGEGHVPALASPGLQFGSSLAGLGQLQSPGAGVGLPNAPSERR
PPPPDFPAPALGGQPGFPFGSGSRQATPHSAPGVNSPPSAGAGSGSSGAAGGAYPPQPDF
QSSQRNSASKLGALSLGSFNKPSSKDNLFGQSCLAALSTACQNMIASLGAPNLNVTFNKK
NPPEGKRKLSQNEPDSAVAAGNPGSDYFPGGTTPGAPGPGGPSGTSGGGSKASGPPNPPI
QGDSTSLSPNYTLESTSGSDGKPVPGGSGRGRGRRKRDSGHVSPGTFFDKYSAAPDSGGA
PGVSPGQQQAPGSAAGGSSVNEARGPTPHEKALTSPSWGKGAELLLGDQPDLMASLDSTA
KSDGSSPHVGEFASDEVSTSYANEDEVSSSSDNTTALAKASRSPLVTSSPKLPPRGVGAG
EHTPKASALGLGILSTSTSTPDSYGGGVGTGHPGTPGLEQVRTPTSSSGAPPPDEIHPLE
ILQAQIQLQRQQFSISEDQPLGLKGSKKTECAVGASGAQNGDSELGSCCSEAVKSAMSTI
DLDSLMAEHSTTWYMPPDKALVDGGDDDKTLAPWEKAKSQNPNNKEVHDHPTNKASATQP
GSHLQCLTVHCTDGDPKARTSVPTWRSLHSDISNRFGTFVAALT
NT seq 3915 nt   +upstreamnt  +downstreamnt
atgtttgggctggaccaattcgagccccagatcaacagccggcacgctggtcagggcgag
gggaactttaacgaagccggactgagtatgaacgctcactttaaggcccctgctttccac
gccgggcctcctcctggccccgtggaccctgcaataagcgctctgggcgaacccccgatc
ttgggtttgaatatggagccatacggcttccatgcgcgcggtcactccgagctgcacgca
ggggggttgcaggcacagcctgtgcacggcttcttcggtggtcagcagcctcaccacagc
catcctggaggccatcacccgcaccagcatcacccacactttgggggcaacttcggtggt
ccggacccaggtgcctcatgtctgcacgggggccggctgcttggctatggaggtgcagcg
agcggcctcggcagccagcctcccttcgcagagagttacgagcacatggcggagagccag
gggccggagggcttcggcccgcagcggccaggaaacctcccggacttccacagttcgggc
acttcgggccacgctgtgcctgccccgtgcctgccgctggaccagagccctaaccgggct
gcctctttccatggcctgtccgcctctagcggctcggattctcacagcttggaaccccgg
agggtgacgaaccaaggagccgtagattcgctggaatacaattacccgagcgagccgccc
tcaggacattttgacatgttttcaccctctgactctgaagggcagctgccacattatgct
gcgggtcgccaggttcccgggggcgctttcccgggtgcttcagccatgcccagagcctca
ggcatggtgggtttgtccaaaatgcacggtcagccaccgcagccaccaccaccccagcag
caaccgcagcacggagtgttcttcgagaggtttggcggggcccggaagatgcctgtgggt
ctggagcctgcagtgggctccaggcacccgctaatgcagcctccccagcaggccccacca
cccccgcagcagcagccccagcagcagcagccaccgccaccacctgggcttctggtccga
cagaattcttgccctcctgcgctcccgcggccccagcagggtgaggctggcacacccagt
ggcggcctgcaggacgggggccccatgctgcccagccaacacgcgcagtttgagtaccct
atccatcggctagagaaccggagcatgcacccatattctgaacctgttttcagcatgcag
catccccctcctcaacaggcacccaaccagaggctgcagcatttcgatgcgcccccctac
atgaacgtggccaagaggccgcgttttgactttccgggcagcacaggcgtggaccgctgc
gcctcgtggaatggcagcatgcacaacggcactctggacaaccaactctctccctccgcc
tacccaggcctcccaggcgagttcacgccgcctgtgccggacagttttccttcaggaccg
cccttgcagcacccggggccggaccaccagtccctgcagcagcaacagcaacagcagcag
cagcagcagcagcagcaacagcagcagcagcagcagcaacaacaacagcagcagcagcag
cagcaacgccagaacgcggccctcatgattaaacagatggcgtcccggaaccagcaccaa
cggttgcgacagcccaatctggcccagctaggccaccctggggacgtgggccagggcggc
cttgtccacggaggttccgtgagcggcttggcccagacgaactttgagcgcgaaggcggc
agcacaggtgcggggcgcctgggtggctttgagcagcaggcgccccacctggcgcaggag
agcgcgtggttcccgggtccacaccctccgggagacctgctgccccggaggatgggcagc
gcggggttgccggctgactgcggcccgcacgaccctggtctggcgcctccccctgctcca
ggtggttcaggggtgctattccgaggctctctgcaggagcctctgaggatgcctggggaa
ggccacgtgcccgcactggcctcgcctgggctgcagtttgggagcagcttggctggccta
ggccagttgcagtcgcccggggccggtgtgggactgcccaacgctccgtcggagcgacgg
cctccgcctccggacttccccgcgccagctctcgggggccagcctggctttccctttggc
tcaggcagccggcaggccacgccgcacagcgctccaggcgtgaattcgcccccgagcgcg
ggcgcgggcagcggcagttccggtgctgctgggggcgcttacccaccacagccggatttc
caatccagccagcgcaactcggccagtaaactgggcgcgctgtccttggggtctttcaac
aagcccagctctaaggacaacctgtttggccagagctgcctggctgcgctctccactgct
tgccagaacatgatcgccagcctgggtgctcctaacctcaacgtgactttcaacaagaag
aacccacccgaggggaagaggaaactgagccagaatgagcccgacagcgcggttgcagcc
ggtaacccgggctcggattacttccccggagggactactcctggggcccctggacccgga
ggcccttccgggaccagtggtggtggctccaaagcctcaggaccgcccaaccctcccatt
cagggggacagcaccagtctttctcccaattacaccctggaatcaacatcgggtagcgat
ggcaagcctgtccctgggggtagtggccggggaaggggacgcagaaaacgggacagtggt
catgtgagccccgggacctttttcgacaaatactccgcagctcctgacagtgggggcgca
ccaggggtgagcccggggcagcagcaggctcctggttcagccgctgggggaagctcagta
aacgaagcccgagggcccacaccccatgagaaggccctcacatcaccatcgtggggaaag
ggagccgagttgctccttggggaccagccggacctcatggcgtccctggacagcaccgcc
aaatcagatggtagttccccacacgtgggtgagttcgcctctgatgaggtgagcacaagt
tatgcgaatgaggacgaagtgtcctctagttctgacaacactacagccctggccaaagcc
agccgaagtcccctggtgaccagctcacccaaactccctcctcgaggagtgggtgctggg
gaacacacaccgaaggcttctgccctgggcctgggcatcctgtctacctctacctcgacc
cctgacagctatggtgggggcgtgggcaccggacatcccggcacaccaggcctggaacag
gtccggaccccaacgagcagcagcggtgcgccgcctcctgacgagattcatcccctggag
atcctccaagcccagatccagctgcagagacagcaatttagcatctcggaggaccaaccc
ctggggctcaagggtagcaaaaaaaccgagtgtgctgtaggggcctctggggcacagaat
ggtgacagcgagctgggtagctgctgctcagaagcagtcaagagcgccatgagcaccatc
gacctggactccctgatggcagaacacagcactacctggtacatgccgcctgacaaggcc
ctggtggatggtggagacgatgacaagacgctggcgccctgggagaaggccaagtcccag
aaccccaacaacaaagaagttcatgaccaccccaccaacaaggcctcagccacccagcct
ggcagtcacctgcagtgtctgactgtccactgcacagacggcgaccccaaggcccgcacc
tccgtacccacctggcggtctctgcactctgacatctccaaccgattcgggacatttgtg
gctgccctgacttga

DBGET integrated database retrieval system