KEGG   Rattus norvegicus (rat): 498229
Entry
498229            CDS       T01003                                 

Gene name
Tmem81
Definition
(RefSeq) transmembrane protein 81
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Izumo-Ig ig Ig_2 Ig_3 V-set Ig_6 I-set
Other DBs
NCBI-GeneID: 498229
NCBI-ProteinID: NP_001017490
RGD: 1561544
Ensembl: ENSRNOG00000028752
UniProt: Q6AXW8
Position
13q13
AA seq 262 aa
MKAVATVFICGSLVLITYLPLVVTSPQTLAIPEKLRQAVGRVVVNATACSVTCGLGYKEE
TSCEVGPDGVRRDCRSQRLECLTNWICGMLHFTIIQRQQFELNCLSSDILTKGQEAFRFT
WKLARGIISTNDELFKPFRANSPFLRFKPAYESDSGTYRCDVQQLKNLKLVKRLYFGLRV
LPPKLVNLNFQQSLTEDQKLAEEGWEVHLDNQSQPHLPGWRKKVSLALGVGIAAGVVGGV
LVNVALCRVLGGTGGNGNLSSL
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaaggctgtggccaccgtttttatctgtgggagcctggtattgataacctacctgcct
ttggtggtgacgtcacctcaaacactggccatccctgagaagctacgacaagctgtgggg
agagtcgtcgtcaacgccacagcatgcagtgttacctgcggcctcggctacaaggaagag
acgagctgtgaggtgggtcccgatggagtgaggagggactgcagatcccagcgtttggag
tgtctgaccaactggatctgcggaatgcttcatttcaccattatccagaggcagcagttc
gagctgaactgtctcagctcagacatcctgacgaaagggcaggaggctttccgcttcacc
tggaagctcgctcggggcatcatctctactaacgacgagctctttaaacccttccgagcc
aactccccctttctacgattcaaaccggcctacgagtctgactctgggacgtatcgatgt
gatgtgcagcagctaaagaacttgaaacttgtcaagaggctctattttggcctgagggtc
cttcctccgaagttggtaaacctaaatttccaacagtcccttacagaggatcagaagttg
gcagaggagggctgggaagttcatctcgacaaccagtctcagcctcacctcccagggtgg
cgaaagaaagtgtcattggctttgggtgtagggatcgccgctggagtggtcggaggtgtg
ttggtgaacgttgctctctgcagggtcctgggagggaccggtggcaatgggaacctcagc
agcttataa

DBGET integrated database retrieval system