KEGG   Rattus norvegicus (rat): 498840
Entry
498840            CDS       T01003                                 

Gene name
Sting1
Definition
(RefSeq) stimulator of interferon genes protein
  KO
K12654  transmembrane protein 173
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    498840 (Sting1)
   04622 RIG-I-like receptor signaling pathway
    498840 (Sting1)
   04623 Cytosolic DNA-sensing pathway
    498840 (Sting1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    498840 (Sting1)
   05171 Coronavirus disease - COVID-19
    498840 (Sting1)
   05168 Herpes simplex virus 1 infection
    498840 (Sting1)
   05163 Human cytomegalovirus infection
    498840 (Sting1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    498840 (Sting1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    498840 (Sting1)
SSDB
Motif
Pfam: TMEM173
Other DBs
NCBI-GeneID: 498840
NCBI-ProteinID: NP_001102592
RGD: 1562552
Ensembl: ENSRNOG00000042137
UniProt: F1M391
Structure
PDB: 
5GRM 5GS5

Position
18
AA seq 379 aa
MPYSNLHPSIPRPRSYRFKLAAFVLLVGSLMSLWMTGEPPSHTLHYLALHVASQQLGLLL
KKLCCLAEELCHVQSRYQGSYWKAVRACVGSPICFMALILLSFYFYCSLENTSDLRLAWH
LGILVLSKSLSMTLDLQSLAPAEVSAVCEEKNFNVAHGLAWSYYIGYLKLILPGLQARIR
MFNQLHNNMLSGAGSRRLYILFPLDCGVPDDLSVADPNIRFRDMLPQQNTDRAGVKNRAY
SNSVYELLENGQPAGACILEYATPLQTLFAMSQDGKAGFSREDRLEQAKLFCRTLEEILA
DVPESRNHCRLIVYQESEEGNSFSLSQEVLRHIRQEEKEEVTMSGPPTSVAPRPSLLSQE
PRLLISGMEQPLPLRTDLI
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgccatactccaacctgcatccatccatcccacggcccagaagttaccgcttcaaactg
gcagccttcgtcttgctggtgggcagcctgatgagcctttggatgacaggggaaccacca
agtcacactctgcattacctagcacttcacgtagcctcgcagcaacttggattactgttg
aaaaagctctgctgtctggctgaagagttgtgccatgtccagtccaggtaccagggcagc
tactggaaggctgtgcgcgcctgcgtggggagtcccatctgctttatggccctgatccta
ctgtcattttatttctactgctccctcgaaaatacttctgacctgcgccttgcttggcat
cttggcatcctggtcctttcaaagtccctaagcatgaccctggaccttcagagcttggcc
ccagcagaagtctctgcggtctgtgaagaaaagaacttcaatgttgcccatggactggcc
tggtcgtactacattgggtacctgaagctgatcttgccaggactgcaggcccggatccgg
atgttcaatcagctacacaacaacatgctctcgggtgcggggagccggcggctgtatatc
ctcttcccattggactgtggggtgcctgatgatctgagtgtggctgaccccaatattcga
ttccgagatatgctgccccagcaaaacacagaccgtgctggcgtcaagaatcgggcttat
tccaacagtgtctatgaacttctggagaatgggcagccggcaggtgcctgtatcctggag
tacgccacccccttgcagaccttgtttgccatgtcacaggatggcaaagctggcttcagt
cgggaggaccggcttgagcaggccaaactcttctgtcggacacttgaggaaattctggct
gatgtccctgagtctcgaaaccactgccgcctcattgtctaccaagaatccgaagaggga
aacagtttctcgctgtctcaggaggtgctccggcacattcggcaagaagaaaaggaggaa
gttaccatgagtggccccccgacctcagtggcacctcgtccctccctactgtcccaagag
ccgagacttctcatcagtggcatggagcagcctctcccactccgcacggacctcatctga

DBGET integrated database retrieval system