KEGG   Rattus norvegicus (rat): 498873
Entry
498873            CDS       T01003                                 

Gene name
MGC105567, Ifgga5
Definition
(RefSeq) similar to cDNA sequence BC023105
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: IIGP MMR_HSR1 RsgA_GTPase AAA_16 Ras Sigma54_activat Dynamin_N Roc ABC_tran Sigma54_activ_2 FtsK_SpoIIIE FeoB_N AAA_24
Other DBs
NCBI-GeneID: 498873
NCBI-ProteinID: NP_001019455
RGD: 1565797
Ensembl: ENSRNOG00000038955
UniProt: Q566C9
Position
18q12.1
AA seq 410 aa
MGQLFSGTAKSEALYSSFSEYFKKFKAENKIISQETITLIELYLILEDLPQANNEITSAL
RKLANTPLNVAVIGESGTGKSSFINVFRGVGHEDETAAPIGVVETTMRRTPYRHPNIPNV
VIWDLPGIGTTNFPPKDYLEKMKFCEYDFFIIISATRFRKNDIDLAKAVSMMKKDFYFVR
TKMDIDLENEMECKDTFSRETFLKHIRSHCVTMFKKNNLHVPPIFLISNRNVSDYDFPIL
KAMLQNKLSTHTYHNIMVSLPNITEAAIERKHTFIQQFIWLEAFKDGVLMTIPVVDTLKD
SDVEKLKMSLNHYRVLFGVDDATLQFMAKDSQVPVEQLRKIIKSPYLLETKKRKALEGML
LKYMEKSASANGGLLATGLYFRKSFYLQLLFLDTVAEDAKVLLRETHSRN
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggtcagctgttctctggcacagctaagagtgaagccttgtactccagcttcagtgaa
tattttaagaagtttaaggcagaaaacaaaatcatttctcaggaaaccatcacattgatt
gaattatacctgatactagaagaccttccgcaggcaaataatgaaattacttctgcattg
agaaaacttgctaacaccccactcaatgtagctgtgataggagagtctggaacagggaag
tccagcttcatcaatgtcttcaggggggttggacatgaagatgaaactgcagctccgatt
ggggtagtggagacaaccatgaggagaactccatacagacatcccaacattccgaatgtg
gttatttgggatctgccggggattggaaccacaaatttcccaccaaaagactatctggag
aaaatgaaattctgtgagtatgacttcttcattattatttcagccacacgctttaggaaa
aacgatatagacctcgccaaagcagtcagcatgatgaagaaggatttctattttgtgaga
accaagatggacatagatctagaaaatgaaatggaatgcaaagacacctttagcagagaa
accttcctgaagcatatccgaagccattgtgtgactatgtttaagaagaataaccttcat
gtgccgccgatcttcctgatctcaaacagaaatgtatctgactatgatttcccgatcctg
aaggccatgctgcaaaacaaactttctactcacacatatcacaacattatggtttccttg
cctaatattacagaggcagccattgaaagaaaacacacctttatacagcagtttatctgg
ctagaagccttcaaagatggagttttgatgactattcctgtagtggacaccctcaaagac
agtgatgtggagaagttaaagatgagtttaaaccactatcgagttctctttggagtggat
gatgcaaccctgcagttcatggcaaaggattcccaagtgcctgttgaacaactgagaaaa
atcattaaatctccttatttgttagaaactaagaaaagaaaagcattagaagggatgctt
ttaaaatacatggagaaatctgcctcagctaatggtgggctcctggcaacaggtctttac
tttaggaaatccttttacttacaacttcttttccttgacacagtggctgaagatgccaaa
gttctccttagagagacacattcaagaaactag

DBGET integrated database retrieval system