KEGG   Rattus norvegicus (rat): 498999Help
Entry
498999            CDS       T01003                                 

Gene name
Ahrr
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    498999 (Ahrr)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    498999 (Ahrr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Motif
Other DBs
NCBI-GeneID: 498999
NCBI-ProteinID: NP_001019456
RGD: 1559857
Ensembl: ENSRNOG00000014721
UniProt: Q75NT5
Position
1p11
AA seq 701 aa AA seqDB search
MMIPSGECTYAGRKRRKPIQKRRLTMGTEKSNPSKRHRDRLNTELDHLASLLPFSPDIIS
KLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEDHSSRGFPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVF
GQSPHADTDNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKTPSGTALPPRLSLFCIVAPVLPSVTEMKMKSAFLKAKHRADIVVTMDSRA
KAVTSLCESELHPKLNYLAGRSNGENVISLFRGQTDRSHWTRALARSSCLCLRGGPDLLD
PKGTSGDREEDDQKHILRRSPGARGQREMHKYSYGLETPVHLRHLDWSTEQRSQEGTTKL
TRQPSKSEPSTCLVPHGSCVPYPGSQGMFSASNMASFRESLDHPTGTYCSQMNRPLPDIH
QGQVDPSTCHIPQGSLGSRIPLSGMQCFTARGFSTEDAKLPSLPVNIGTPCNPVLSLEVP
IKMENESGSQDIVEASTTSCVWLGTGDMTRRHLVGFPARMHLKTEPDYRQQVCTPHRGHG
ILGTNPHSRDTVGSCREHAPLYSAHCTCLSPEPPHHLFMCSHSESQHPSLDQDCRAPIVK
REPLDSPSWAAPGHVTVPRMFPKNASITVIPSKGSDGIFLP
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgatgattccgtcaggagagtgcacgtatgccggtaggaagaggaggaaacccattcag
aagcggaggcttaccatgggaactgagaaatcaaatccttccaaacggcaccgggaccgc
ctcaatacagagctggaccacctggccagcctgctgccattttcacccgacatcatctcc
aagctggacaaactttcagtccttcgcctcagcgtgagttacctcagggtgaagagcttc
ttccaagccttgcaggagacatgtgtatggtcagctccagctctgtcacctgaagatcac
tcatccagaggcttccctgtgcaggaagggcggctgctgctggagtctctcaatggcttt
gctctggtggtgagtgcggaagggatgatcttctacgcgtcggcaacaattgtggactac
ctgggcttccaccagacagatgtaatgcatcaaaatatttatgactatatccatgtggat
gaccggcaggacttctgcagacagctacactgggccatggaccctcctcaggtggtgttc
gggcagtccccacatgctgacacagacaataccgtcctagggaagttgctcagggcccaa
gaagggggcaagggcttgccctcagagtactcggccttcttgacacgctgcttcatttgt
cgtgtccgctgcctgctggacagcacctctggcttcctgactatgcagttccaaggaaaa
ctaaaattcctgtttggacagaagaagaagacaccatcaggaacagccttgcctcctcgg
ctctccttgttttgcattgtggcgccagtgctgccttctgtgactgagatgaaaatgaaa
agtgcattcttgaaggcaaagcacagggcagacattgtggtcacgatggactcaagggca
aaagctgttacaagtctgtgtgaatcagaactgcatcccaaactcaattacttagcagga
aggagcaatggagaaaatgtcatttcactgttcaggggacaaacagataggagccattgg
acccgggctctagccaggtcttcatgtctgtgcctcaggggtggtcctgacctgctggac
cccaaggggacttcaggggacagagaagaggacgatcagaagcacatactaaggagatcc
cctggtgcccgggggcagagggagatgcacaagtacagctatggcttggagacaccagta
cacttgaggcacctggactggagcacagagcagcgaagtcaggagggcactaccaagcta
actcggcagcccagtaagagtgagccatccacatgcctggtgccccatggttcctgtgtg
ccctaccctggaagtcaaggcatgttcagtgccagcaacatggcttctttcagggagtcc
ctagaccatcccactggtacctactgcagtcagatgaacagacccttgccagatatccac
cagggccaggtggatccttccacctgtcatatcccccagggaagtctgggctctaggatc
cctctgtctggaatgcagtgcttcaccgccaggggattttctacagaggatgcaaaattg
cccagcttgccagtgaacataggcaccccgtgcaatccagtattgtcactggaagtgcca
atcaagatggagaacgaatctgggtcccaggatatagttgaagccagcacaactagctgt
gtgtggctgggaaccggcgacatgaccagaagacatctggttggtttccctgccaggatg
catctgaaaacagagcctgactataggcagcaggtctgtaccccacaccgtgggcatggt
atactggggactaatccccacagcagagacactgtggggtcctgtagggagcatgctcct
ctttactctgcacactgcacctgcctgagtccagagcctcctcatcacctcttcatgtgt
agccacagtgaaagtcagcatccctccttggaccaagactgcagagctcctattgttaag
cgtgagcctctggactcaccatcatgggctgctcctggtcatgtgactgtgcccaggatg
ttccctaagaatgcctctataactgtgatcccatccaaaggatctgatgggattttccta
ccctag

DBGET integrated database retrieval system