KEGG   Rattus norvegicus (rat): 499124
Entry
499124            CDS       T01003                                 

Gene name
Zfp14, Zfp968
Definition
(RefSeq) ZFP14 zinc finger protein
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    499124 (Zfp14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    499124 (Zfp14)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    499124 (Zfp14)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz C1_4 zf-met zinc_ribbon_15 DUF3268 Syntaxin_2 zf-LYAR
Other DBs
NCBI-GeneID: 499124
NCBI-ProteinID: NP_001094461
RGD: 1560188
Ensembl: ENSRNOG00000030932
UniProt: A1A5R5
Position
1q21
AA seq 501 aa
MARAQGLVTFRDVAVDFSQEEWEFLDPAQKNLYRDVMWENYSNFISLDLESRFKTDTSSL
DKDICEVYSVQWELIEKIKNLSPQVSGLSDGQEHKPKTGLQKEPQEGYFGQLKITSKKVT
YEKHSFLSEYQRVQNGEKFYECKECRKTFIRRSTLSQHLRIHTGEKPYKCKECGQPFRQR
AHLIRHHKLHTGEKPYECKDCGKAFTVLQELTQHQRLHTGEKPYECKECGKAFRVHQQLA
RHQRIHTGEKPYSCKDCGKTFRQCTHLTRHQRLHTSEKLYECKECGKAFVYGPDLRVHQK
THFGEKPYACKDCGKSFRICQQLTVHQSIHTGEKPYACKECRKTFRLRQQLVRHQRVHTH
KRPYECLECWKTFSSYSQLISHESIHVGERPYGCEECGKAFRLLSQLTQHRSIHTGEKPY
ECQECRKPFRLLSQLTQHRSIHTGEKPHECKECGKTFRLYSFLSQHQRIHTGERPYKCKE
CKKAFRQHSHLTQHQKIHSGT
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcacgcgctcaggggttagtgacgttcagggatgtggctgtggatttctctcaggag
gagtgggaattcctggaccctgctcagaagaacctgtacagggatgtgatgtgggagaac
tacagcaattttatctcactggatctggagtccagattcaagactgatacttcatcttta
gacaaggacatttgtgaagtatattcggtacagtgggagttaattgagaaaattaaaaac
cttagccctcaggtttctggtctcagtgatggtcaggaacataaacccaagactgggcta
caaaaggaaccacaggagggttattttgggcagttgaaaattacctccaaaaaagtcacg
tacgaaaagcacagttttctttccgagtaccagagagttcagaatggagaaaagttctat
gagtgtaaagagtgtaggaagacctttatccgccgctcaacactcagtcaacacttgagg
atccacactggcgagaaaccttacaaatgcaaggagtgcgggcaacccttccgacagcgg
gcgcacctcatccgacaccacaaacttcataccggcgagaagccctatgagtgtaaggac
tgtgggaaggcgtttacggtgctccaggagctcacacagcaccagcggcttcacactggc
gagaagccctatgagtgcaaggagtgtgggaaggccttccgggtacatcagcagctggct
cggcatcagaggatccacactggggagaaaccctactcgtgcaaggactgcgggaagacc
ttcagacagtgcacacaccttacccgacaccagaggcttcacacttctgagaaactatac
gaatgtaaggagtgtgggaaagccttcgtgtatggcccagacctgcgagtgcatcagaag
acccactttggcgagaagccctatgcatgtaaggactgtggcaagtccttcagaatatgc
caacagctgacggtccaccagagcattcacactggggagaaaccctatgcgtgtaaggag
tgcaggaagaccttcagactgagacagcagcttgttcgccaccagagagtccatacccac
aagagaccctatgagtgtctggaatgctggaagacctttagcagttactcccagctgatt
tcacatgagagcattcacgttggcgagagaccctatggctgtgaagagtgtggcaaggcc
ttccggctcctctcgcagctcacacagcaccggagcatccacacgggcgagaagccttat
gagtgccaggagtgtagaaagcccttccggcttctctcacagctcacacagcaccggagc
atccacacgggcgagaagcctcatgagtgcaaggagtgcggcaagacttttagactttat
tcctttctttctcaacaccagaggatccacactggtgagaggccctacaagtgcaaggag
tgtaagaaagccttccgacaacactcacacctcacccagcaccagaagatccacagtgga
acctga

DBGET integrated database retrieval system