KEGG   Rattus norvegicus (rat): 499125
Entry
499125            CDS       T01003                                 

Gene name
Sdhaf1, Lyrm8, RGD1562079
Definition
(RefSeq) succinate dehydrogenase complex assembly factor 1
  KO
K18167  succinate dehydrogenase assembly factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    499125 (Sdhaf1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-II assembly factors
    499125 (Sdhaf1)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_1 Complex1_LYR_2
Other DBs
NCBI-GeneID: 499125
NCBI-ProteinID: NP_001171158
RGD: 1562079
Ensembl: ENSRNOG00000047045
UniProt: B0K036
Position
1q21
AA seq 118 aa
MSRLSRLQRQVLSLYRELLRAGRGKPGAEARVRAEFRQHASLPRSDVLRIEYLYRRGRRQ
LQLLRSGHATAMGTFVRPRGPTEEPVDATAPGNRLDDSDALKNPCEGTGARETRSDGR
NT seq 357 nt   +upstreamnt  +downstreamnt
atgagccggcttagccggctgcagaggcaagttctgagcctgtaccgcgaactgctgcgc
gccgggcgcgggaagccgggcgccgaggcacgggtgcgggccgagttccggcagcacgcc
agccttccgcgctccgacgtgctgcgtatcgagtatctgtatcgccggggacggcgccag
ctacagctgctgcgttccggccacgccacggccatgggtactttcgtgcgcccgcggggc
cctactgaagaacccgtcgacgcgacagccccggggaacaggctggacgatagtgatgcc
ctaaagaatccttgtgaaggcacgggagcacgggaaacgcgatccgatggacggtga

DBGET integrated database retrieval system