KEGG   Rattus norvegicus (rat): 499437
Entry
499437            CDS       T01003                                 

Gene name
Mcm9, RGD1560557
Definition
(RefSeq) minichromosome maintenance 9 homologous recombination repair factor
  KO
K10738  DNA helicase MCM9 [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    499437 (Mcm9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     499437 (Mcm9)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    499437 (Mcm9)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid Mg_chelatase AAA_5 AAA_3 RuvB_N AAA_16 AAA AAA_7
Other DBs
NCBI-GeneID: 499437
NCBI-ProteinID: XP_008771230
RGD: 1560557
Ensembl: ENSRNOG00000003281
UniProt: K3W4U8
Position
20q11
AA seq 1128 aa
MNSEQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPLVVNAMTLFETNMEIGDYFTV
FPNEVLTVFDSALRRSALAVLQSLPEPEGLSMKQNLHARISGLPVCPELVREHIPKTKDV
GHFLSVTGTVIRTSLVKVLEFERDYMCNKCKYVFTVKADFEQYYTFSRPSSCPSSDTCDS
SKFTCLSDLSASPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTI
YGVVMQRWKPFQRDMRCEVEIVLKANYVQVNNEQSSGMVMDEDARKEFEDFWEHYKSDPF
AGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRVRGESHLLLVGDPGTGKSQ
FLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFNSLK
EHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGQYDPQESVSVNIALGSPLL
SRFDLILVLLDTRNEDWDRIISSFILENKGYPSKSENLWSMEKMKTYFCLIRNLHPTLSD
VSNQVLLRYYQMQRQSDSRNAARTTIRLLESLIRLAEAHARLMFRSTVTLEDAITVVSVM
ESSMQGGALLGGVNALHTSFPESPRAQYRRQCELILEKLELQSLLQEELRRLERLQNESD
QCQPHSPEVEAAPGSCRNDPRDRPGLRTPTQQEQSCSWSPAESSGGDSPTGPGLSRPTSC
NHKAEDGGGRGDCLAWADPTASPEIAQESTIVSPGLKTMEEKEDLKISNNGAQGKGKHGL
QKRSQLLKPGRLPASGATDTSLRSRGSESTRARQAAVVSEAGRDDDQESGLTHGPRRLPR
LLKEGSQSVCTTRVRTLPPTVPFPLSISPPGPGKKTGTPKRKRQKSAQVEAPGPEGTETM
SAPVVKLAKFTFKQKSKLTHSPEGQGPMPPSASKVAVDSSKIPRQRTRREAGVPAAGPGQ
STSTSGDRCSEQLQGQTKALSRQPPESHRPREEKEQGPERRVIQSELELGSQAGHSHPAC
KKDRKEGASCSNKSKVHAGTMARLANFSFTSPPESKSESLPPERKESRDRSHNPPATTAP
VLGQQRQSFQLQQPPERVNLSTLSLFTLSELDDEALDFDWDEEMRKKP
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgaacagtgagcaggtcacgctggtgggtcaagtgtttgagtcctacgtttcagagtac
cacaagaacgatattcttctgatcttgaaagaaagggacgaagatgctcactacccactt
gtggtcaatgctatgacccttttcgagacgaacatggaaattggagactatttcactgtg
ttccccaatgaagtactgacagtctttgacagcgcgcttcgaaggtcagccttggccgtt
ctgcagtcccttcctgagcccgagggcttgtctatgaagcagaatctccatgccaggata
tcaggtttgcctgtttgtccagaactggtcagggaacacattcctaaaaccaaggacgtg
ggacacttcttatctgtcactgggacagtgatccgaacgagtctggtgaaggtcctggag
ttcgagcgggattacatgtgtaacaaatgcaagtatgtgttcacggtgaaggctgacttt
gagcagtattacaccttcagtcggccatcttcatgtccaagctcagacacctgtgactcc
tccaagttcacctgcctctcagacttgtctgcatctccagccagatgtcgggattaccag
gaaatcaaaattcaggagcaggtgcaaaggctgtctgtgggaagtatcccacggtctatg
aaggtcattctggaagacgacctagtagacagctgcaagtctggagatgacctcaccatc
tatggggttgtaatgcaacggtggaaaccctttcagcgagatatgcgctgtgaagtggag
attgtcttgaaagccaactatgtccaagtgaataatgaacagtcctcagggatggtcatg
gatgaggatgctcgaaaagaatttgaagacttctgggaacactataagagtgaccccttt
gcagggaggaatgaaatattggccagcttgtgtcctcaagtgtttgggatgtatctagtg
aagcttgctgtggccatggtcctggctggtggaattcaaagaactgatgctgcaggaaca
agggttagaggcgaatctcaccttttattggttggggatcctggcacagggaaatcgcaa
ttccttaaatatgcagcaaagattacaccgaggtctgttttgaccacaggaattggatct
actagtgcaggtctgacagtgacggctgtgaaagactcaggagaatggaatctagaggct
ggggccctcgtgcttgcagatgctggtctctgctgtattgatgaatttaacagcctcaaa
gaacatgacaggaccagcatccatgaagcaatggagcagcaaaccataagtgtggctaag
gctggccttgtttgtaagctgaacacaaggaccaccattctggcagcaactaaccccaaa
ggccagtatgacccccaggaatctgtgtctgtgaacattgccctcggcagcccactcttg
agtcggttcgacctcatcctggttttgctcgacacgaggaatgaagactgggatcgcatc
atttcttcctttattttagaaaataaaggttatccaagtaaatcggagaacctgtggagc
atggagaagatgaaaacctacttctgcctcatccggaatctccaccccacgctgtctgat
gtgagcaatcaagtactcctccgatactaccaaatgcaaaggcagagcgattcccggaac
gcagcccggacaaccatccgcctgttagaaagcctgatccgattagcagaagcccacgct
cgcctgatgttccgcagtaccgtgactttggaagatgctatcacagtggtgtccgtgatg
gaatcctcaatgcagggaggtgcactgctaggaggtgtgaacgctcttcacacttccttc
cctgaaagcccacgggcacagtaccggaggcagtgtgagctcattctggaaaagctggaa
ctccagagtctcttgcaggaagaacttagaagacttgaaaggttacagaatgagagtgac
cagtgccagccacattcaccggaggtggaggcggctccaggctcctgcagaaatgatcca
agggacagaccaggcctcaggacgccaacacagcaggaacagagctgtagctggagtccc
gcagagagctctggtggagactccccgacaggtccagggcttagtagaccaacaagctgt
aaccacaaggctgaggacggaggtggcagaggtgactgtttagcctgggccgaccccacg
gcaagtcctgagattgcacaggaaagcactattgtgtctcccggtctgaaaacgatggag
gaaaaggaggatttgaaaatctctaacaatggagctcagggcaaggggaagcatgggctc
cagaaaagaagccaattactaaaacctgggcgtcttccagcatcaggagccacagacact
tccttacggtctcgcggctctgagagtacgagggcaaggcaggcagcagttgtctctgaa
gcaggacgggatgatgaccaagagtctggactgactcatgggccccgaagactccccagg
ctgctgaaggaggggtcccagagtgtgtgcacaaccagagtgcgaacactgccacccacg
gtcccctttcccctgtccatctctccacctgggccaggaaaaaaaacaggaacaccaaaa
agaaagagacagaaatctgcgcaggtggaagctcctggacctgaaggtactgagactatg
agtgctccagtagtgaagctggccaaattcacgtttaaacagaagagcaaactgacccac
tcccctgaaggccaaggccccatgcctcccagcgctagtaaagtagcagtcgacagttct
aaaattccccgacaaagaacaagaagagaagcaggtgtgcctgcggcagggccaggacag
tcaacatccacctcaggagacagatgctctgagcagctgcagggacagacaaaggcgctc
tcaaggcagccaccagagagccatcgaccgagagaggagaaggagcagggccccgaaaga
agggttattcagtctgaactggagcttgggagccaggctgggcattcacatccagcttgt
aagaaagaccgaaaggaaggggcttcctgcagtaataaaagcaaggttcacgctggcacg
atggccagactggcaaacttctccttcacttccccaccagaatccaaatcagaatccctc
cctcctgaaaggaaggagagcagggacaggagccacaaccctcctgcgaccacggctccg
gtgcttggccagcaaaggcagtctttccagctgcagcagccccctgagagagtgaatctt
tccaccctctccctcttcactctgtcagaactggatgacgaggcgttagattttgactgg
gatgaagagatgagaaaaaagccatga

DBGET integrated database retrieval system