KEGG   Rattus norvegicus (rat): 499801
Entry
499801            CDS       T01003                                 

Gene name
Ifih1, RGD1560496
Definition
(RefSeq) interferon induced with helicase C domain 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    499801 (Ifih1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    499801 (Ifih1)
   05171 Coronavirus disease - COVID-19
    499801 (Ifih1)
   05164 Influenza A
    499801 (Ifih1)
   05162 Measles
    499801 (Ifih1)
   05168 Herpes simplex virus 1 infection
    499801 (Ifih1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    499801 (Ifih1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     499801 (Ifih1)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   499801 (Ifih1)
SSDB
Motif
Pfam: RIG-I_C CARD_2 RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_22 AAA_19 DUF3638
Other DBs
NCBI-GeneID: 499801
NCBI-ProteinID: NP_001102669
RGD: 1560496
Ensembl: ENSRNOG00000006227
UniProt: G3V6W5
Position
3q21
AA seq 1027 aa
MSTVCSAEDSFRNLISIFRPRVKMNIQVEPVLDYLVFLPAETKEQILRKVTTCGNTSAAE
LLLSTLEQGQWPLGWTQMFVEALEHSGNPLAARYVKPSLTDLPSPSSETAHDECLHLLNL
LQPTLVGKLLINDVLDTCSEKGLVTVEDRNRISAAGNSGNESGVRELLRRIVQKENWFST
FLDVLRQTGNDALVQELTGVSCPEESTDLDNASHKDRPAANEPLLPAIDALSLETEAWTI
EDTSPEASFADSSVTTESDTSLAEGSVSCFDESLGHNSNMGRDSGTMGSDSDEDTIMGTK
RASPKPELQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQACESGK
VIVLVNKVMLAEQLFRKEFNPFLKKWYRIIGLSGDTQLKISFPEVVKSYDVIISTAQILE
NSLLNLESGEDDGVQLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLKNHKLKKQNKPT
IHLPQILGLTASPGVGAAKKQSEAEKHILNICANLDAFTIKTVKENLSQLKHQIKEPCKK
FVIADDTRENPFKEKLLEIMASIQTYCQKSPLSDFGTQHYEQWAIQMEKKAAKDGNRRDR
VCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAALNDSDESDDDEASSCHDQ
LKGNVKKSLKLDETDEFLMNLFFDNKKMLKKLAENPKYENEKLIKLRNTILEQFTRSEES
SRGIIFTKTRQSTYALSQWIMENEKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKF
RTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSGS
GVTEREIVNDFREKMMYKAINRVQNMKPEEYAHKILELQVQSILEKKMKVKRSIARQYNS
DPSLITLLCKNCSTLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKALQMKFADYQTNG
EIICKCGQAWGTMMVHKGLDLPCLKIRNFVVNFKNNSSKKQYKKWVELPIRFPDLDCSEY
CLYSDED
NT seq 3084 nt   +upstreamnt  +downstreamnt
atgtcgaccgtctgttctgcagaggacagcttcaggaatctcatctcaatcttcaggccc
agggtgaaaatgaacattcaggtggagccggtgctggactacctcgtctttctgccggca
gaaaccaaagagcagattcttagaaaggtcaccacctgtggtaacaccagcgccgcagaa
ctgctgctgagcaccttggagcagggacagtggccgctgggatggacgcagatgttcgtc
gaggccctggagcacagtggcaaccctctagccgcgcgctatgtcaaacccagtcttact
gatctgccctctccttcctctgagaccgcccatgatgagtgtctccacttgctgaacctc
ctccagcccactttagtgggcaagctcctgattaatgatgtcttggatacttgctccgag
aagggactggtgacagtcgaggacagaaatcggatttctgctgcgggaaatagtgggaat
gagtcaggagtaagagaactgctgagaaggatagtgcagaaagaaaactggttttctacc
ttcctggatgttcttcgccaaactggaaacgatgcgctagtccaagagctaacaggtgtg
agctgcccagaagagagcacagacttggataacgcatctcacaaagacaggcctgcagct
aacgagccccttctgcccgccatcgatgcattaagtctggagacagaggcctggaccata
gaggacacctcaccagaggcttcctttgcagattcttctgtgaccacagaatcagacaca
agtttggcagaaggaagtgtcagctgcttcgatgaaagtcttggacataacagcaacatg
ggcagggattcaggcaccatgggaagtgattcagatgaagataccatcatggggacaaaa
agagcatcccccaagccagaactgcagctcaggccttaccaaatggaagtggcccagcct
gccctggatgggaagaatattattatctgcctccccacggggagcgggaaaaccagagtg
gcagtttacatcaccaaagatcacttagacaagaagaagcaggcgtgtgaatccgggaag
gttatcgtccttgtcaataaggtaatgttagcagaacaacttttccgcaaagagttcaac
ccgttcttgaagaaatggtatcgcattattggattaagcggcgatacccagctgaaaata
tcttttccagaagttgtcaaatcttacgatgttattatcagcacagctcaaatccttgaa
aactccctcttaaatctggagagtggggaagatgatggtgtgcagctgtcagacttttcc
cttattatcattgacgagtgtcatcataccaacaaggaggcagtctataacaacatcatg
agacggtatttgaagcagaagttgaaaaaccataaactcaagaaacaaaacaaaccaaca
attcacctgcctcagatactaggactgacagcttcaccgggtgttggagcagccaaaaag
caatctgaggctgaaaaacatattttaaatatatgtgccaatctcgatgcctttaccatt
aaaacagtgaaagagaatctcagtcaactcaaacaccaaataaaggaaccatgcaagaag
tttgtgattgctgatgacaccagagagaatccatttaaagagaaacttctagaaattatg
gcaagcattcaaacttactgccaaaagagtccattgtcagattttggaacccaacattat
gagcagtgggctattcaaatggaaaaaaaagctgctaaagacggaaatcgcagagatcgt
gtctgtgcagaacatttgaggaagtacaacgaagccctacaaatcaatgacacgatccga
atgattgacgcgtacagccacctggaaacgttctacaccgacgagaaagaaaagaagttt
gcagccctcaatgacagcgatgagagtgacgacgacgaggccagcagttgccatgaccaa
cttaagggcaatgtaaagaaatctttgaaactggacgaaacggatgaatttctcatgaat
ttgttcttcgataacaagaaaatgttgaaaaaactagctgaaaacccaaagtacgagaac
gaaaaactcattaaattaagaaacacgatcctggaacagttcacaaggtctgaggagtcc
tcccgaggaattattttcacaaaaacgcggcagagcacctatgcgctttcccagtggatt
atggagaatgaaaagtttgcggaagttggagtcaaagcgcatcacctgattggcgcggga
cacagcagcgaggtcaagcccatgactcagactgaacaaaaagaagtcattagtaaattt
cgcactggggaaataaatctgcttatcgctactacggtggcagaggaaggcctggatatc
aaagaatgcaatatcgttatccggtatggccttgtcacgaacgagatagccatggtccag
gcccggggtcgagctagagccgatgagagcacctacgtcctggttaccagcagtggctcg
ggagttactgaacgggagattgttaatgatttccgagagaagatgatgtataaagctatt
aaccgtgttcaaaatatgaaaccagaggagtatgcacataagattttggaattacaagtg
caaagtatcttggaaaagaagatgaaagtcaagagaagtattgcgaggcagtacaacagc
gatccatcgttaataacacttctctgcaaaaactgtagtacgctggtctgctcaggagaa
aacatccacgtaattgagaagatgcatcatgtcaacatgacaccagagttcaagggactc
tacattgtgagagagaacaaagcactacaaatgaaatttgctgattatcagacaaatgga
gagattatctgcaaatgtggccaagcttggggaacaatgatggtgcacaaaggtttagat
ttgccttgtcttaaaataaggaattttgtagtcaatttcaaaaataactcatcaaagaaa
cagtacaagaagtgggtggaattgcctatcagatttcctgatctcgattgctcagagtac
tgcttgtatagtgatgaagactag

DBGET integrated database retrieval system