KEGG   Rattus norvegicus (rat): 500057
Entry
500057            CDS       T01003                                 

Gene name
Zfp800, RGD1560157
Definition
(RefSeq) zinc finger protein 800
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-C2H2_assoc2 zf-C2H2_4 zf-C2H2 zf-C2H2_11 zf-C2H2_2 zf-met zf-Di19 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_8 zf-H2C2_2 zf-C2H2_12 zf-C2H2_6 FAM35_C
Other DBs
NCBI-GeneID: 500057
NCBI-ProteinID: NP_001102695
RGD: 1560157
Ensembl: ENSRNOG00000007662
Vega: OTTRNOG00000001411
UniProt: D3ZPQ4
Position
4q22
AA seq 664 aa
MPLRDKYCQTDHHHHGCCEPVYILEPGDPPLLQQPVQTSKSGIQQIIECFRSGTKQLKHI
LLKDVDTIFECKLCRSLFRGLPNLITHKKFYCPPSLQMDDNLPDVNDKQSQAISDLLEAI
YPRVDKREYIIKLEPIETNQNAVFQYISRTDNPAEVTESSSTPEQTEVQIQETSSEQPKA
VPEADTEVEEAIEPPPVETVADEATAPTEEQPQESQADLETSDSSDLGHQLICCLCRKEF
NSRRGVRRHIRKVHKKKMEELKKYIETRKTPNQSSKGRSKSALVSLSRSCPVCCKSFATK
ANVRRHFDEVHRGLRRDSITPDIATKPGQPLFLDSASPKKSFKTRKQKSSKAEYNLTACK
CLLCKRKYSSQIMLKRHMQIVHKITLSGANSKREKGPNNTANSSEVKVKVEPGDSVESSP
PSITHSPQNELKGTNHSNEKKNTPATQKNKVKQDSESPKSASPSAAGGQQKTRKPKLSAG
FDFKQLYCKLCKRQFTSKQNLTKHIELHTDGNNIYVKFYKCPLCTYETRRKRDVIRHITV
VHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPSRDEAKHNDSKHDGTSNSPSKKY
EVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHKKTHKANATTSPEGNKTKGRSTRS
KALV
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgcctttgagggacaaatactgtcaaaccgaccaccaccatcacggatgctgcgaacca
gtttatatcctggagcctggagatcctcctttgttacagcaaccagtacagacatccaaa
tccggtattcagcaaataattgagtgctttcgatcaggaaccaaacaacttaaacatatt
ttattaaaagatgtggacactatttttgaatgtaaattatgccgtagtctctttagagga
ttaccaaatttaattacccataaaaaattttactgcccaccaagtctccaaatggatgac
aatcttcctgatgtaaatgataaacaaagccaagccataagtgatctcctagaagccata
tatccaagagtggacaagagagaatatattattaagctagaacccatagaaaccaaccaa
aatgcagtgtttcaatatatttcaaggactgataatcctgctgaagtgacagagtcgagc
agtacccctgaacaaactgaagttcaaatacaggagacaagctcagaacagccgaaagca
gtgcccgaggcagacacagaggtggaggaggccatagagcctcctcctgtggagactgtt
gccgatgaagccacagcccccaccgaggagcagcctcaggaatcacaggctgacctggag
acatctgacagctctgaccttggccaccagttgatatgttgtctttgtagaaaagaattc
aattctagacgaggtgtacgtcgtcatattcgaaaagtacacaagaaaaagatggaggaa
ctaaaaaaatacatcgagacccggaagactccaaaccagtcttccaaaggacgcagtaag
agtgctctagtttcattaagtaggagttgtccagtttgttgtaaatcatttgctacaaaa
gcgaatgtaaggaggcattttgatgaagttcacagaggactgaggagggattcaattact
cctgatatagcgacaaagcctgggcaacctttgttcctggattccgcttctcctaaaaaa
tcttttaagactcgaaaacaaaagtcttcaaaggctgaatacaatttaactgcatgcaaa
tgcctcctttgcaagaggaaatacagttcacaaataatgcttaagagacatatgcaaatt
gttcacaagataactctttctggagcaaactctaaaagagagaaaggccctaataatact
gccaacagttcagaagtaaaagttaaagtcgagccaggagattctgtagagtcttcgccc
ccttccattacccattctccacagaatgaactaaagggaacaaatcattcaaatgaaaaa
aagaacacaccggcaacacagaaaaataaagttaaacaggactctgaaagccctaaatca
gctagtccttcagctgcaggtggccagcaaaaaaccaggaaaccaaaactttcagctggc
tttgactttaagcaactttactgtaaactctgtaaacgccagtttacttccaagcagaac
ttgactaaacacattgagttgcacacagatggaaataacatttatgtcaagttctataag
tgtcctctctgcacttatgaaactcgtcggaaacgtgatgtgataagacatataactgtg
gttcataaaaagtcatctcgttaccttgggaaaataacagccagtttagagatcagagct
ataaaaaagccaattgattttgttctaaacaaagtggcgaaaagaggcccttcaagggat
gaagcaaaacataatgattcaaaacacgatggcacttccaattctcctagtaaaaagtat
gaagtagctgacgtcggtattgaagtgaaagtcacaaaaaacttttctcttcacagatgc
aataaatgtggaaaggcatttgccaaaaagacttaccttgaacatcataagaaaactcat
aaggcaaatgctaccacttcacctgaaggaaacaaaaccaaaggccgaagtacaagatct
aaggctcttgtctga

DBGET integrated database retrieval system