KEGG   Rattus norvegicus (rat): 500133Help
Entry
500133            CDS       T01003                                 

Gene name
Nod1, RGD1562269
Definition
(RefSeq) nucleotide-binding oligomerization domain containing 1
  KO
K08727  nucleotide-binding oligomerization domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05133  Pertussis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    500133 (Nod1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    500133 (Nod1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    500133 (Nod1)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   500133 (Nod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT LRR_6 CARD NLRC4_HD2 LRR_4 NOD2_WH RsgA_GTPase AAA_16 AAA_22 AAA_18 Sigma54_CBD ABC_tran
Motif
Other DBs
NCBI-GeneID: 500133
NCBI-ProteinID: NP_001102706
RGD: 1562269
Ensembl: ENSRNOG00000010629
UniProt: D4ADT7
Position
4q24
AA seq 953 aa AA seqDB search
MEKRGQHEMEGVPAGCHSHIKLLRINREHLVTNIRNTQCLVDNLLENGYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYVLQQLEDAYVDLRLWLSEIGFSPSQLIRTKTI
VNTDPVSRYTQQLRHQLGRDSKFMLCYAQKEDLLLEETYMDTLMELVGFNNENLGSLGGL
DCLLDHSTGVLNEHGETVFVFGDAGVGKSMLLQRLQSLWASGRLASKAKFFFHFRCRMFS
CFKESDTLTLQDLLFKHFCYPEQDPEEVFSFLLRFPHTALFTFDGLDELHSDFDMSRVPD
SCCPWEPAHPLVLLANLLSGRLLKGAGKLLTARTGVEVPRQLLRKKVLLRGFSPSHLRAY
ARRMFPERTAQEHLLQQLDANPNLCSLCGVPLFCWIIFRCFQHFHTAFEGSSQLPDCAVT
LTDVFLLVTEVHLNRTQPISLMQRNTRSPAETLRAGWRTLQALGEVAHRGTDRSLFVFGQ
EEVQASKLQEGDLQLGFLRALPDVGPEQSQQSYEFFHLTLQAFFTAFFLVADDKVSTQEL
LRFFREWTSPGEATSRSCYPSFFSFQCLGSGSRLGPDPFKNKDHFQFTNLFLCGLLAKAR
QKLLQQLVPKAILRKKRKALWAHLFASLRSYLKSLPRVQSDGFNQVHAMPTFLWMLRCIY
ETQSQKVGRLAARGISADYLKLAFCNACSADCSALSFVLHHFHRQLALDLDNNNLNDYGV
RELQPCFSRLTVIRLSVNQITDMGVKVLCEELTKYKIVTFLGLYNNQITDIGARYVAQIL
DECRGLTHLKLGKNRITSEGGRCVAQAVKNSTSIVEVGMWGNQIGDEGAKAFAEALRDHP
SLTTLSLAFNGISPEGGKSLAQALKQNTTLTIIWLTKNELNDEAAECFAEMLRVNQTLKH
LWLIQNHITAEGTAQLARALQKNTTITEICLNGNLIKPEEAKVFENEKRIICF
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcgcggccaacatgagatggaaggcgtcccagccggttgtcactcccacatt
aaactgttgaggatcaacagggaacacctggtcaccaacattcggaacactcagtgcctg
gtggacaacttgctggagaacggttacttctcagccgaggatgcagagatcgtgtgtgct
tgtcctacccagcctgacaaggtccgaaagatccttgacctggtgcagagcaaaggtgag
gaggtgtctgagttcttcctctacgtgctacagcagctggaggatgcttacgtggacctc
aggctgtggctatcagagattggcttctccccttcccagctcatccggaccaaaactatc
gtcaatactgacccagtaagcaggtatacccagcagctgcgacaccaactgggccgcgat
tccaagttcatgctgtgctacgctcagaaggaggacctgctgctggaggagacctatatg
gacacactcatggagctggtaggcttcaacaatgaaaacctgggcagcctaggaggcctg
gattgcctgctggaccacagcacaggtgtcctcaacgagcatggcgagactgtcttcgtg
ttcggggacgcgggagttggcaagtccatgttgctacagaggttgcagagcctctgggcg
tctggcaggctggcctcaaaagccaaattcttcttccactttcgctgccgtatgttcagc
tgcttcaaggagagcgacacattgactctgcaagacctgctcttcaagcatttctgctac
ccggagcaggaccccgaggaggtgttctccttcttgctgcgctttccccacacagcgctc
ttcacttttgacggcctggatgagctgcactcagacttcgacatgagccgcgtgccggac
agctgctgcccctgggagccggcgcaccctctggtcctgctagctaacctcctaagcggg
aggttgctcaagggtgcgggcaaactgctcactgctcgcacaggcgtggaggtcccccgc
cagctcctgcgcaaaaaggtgctgctccggggtttttcccccagccacctgagagcctat
gcccgccggatgttccccgagcgcaccgcgcaggaacatctgctgcagcagctggatgcc
aaccccaacctctgcagcctgtgcggggtgccgctcttctgctggatcatcttccgatgt
ttccagcatttccacacggccttcgagggctcctcgcagctgccggactgcgctgtgacc
ctgaccgatgtctttctgctggtcaccgaggtgcatctgaacaggacgcagcccatcagc
ctgatgcagcgaaacacgcgcagcccggcggaaaccctacgtgcaggctggcgcacgctg
caggcgctgggagaggtggctcaccgaggcacggacaggagtctctttgtgtttggccag
gaggaggtgcaggcgtcgaaactgcaggaaggggatctgcagctgggtttcctgcgggct
ttgcccgatgtgggccctgaacaaagtcagcagtcttatgaatttttccaccttacgctc
caggctttcttcactgccttcttcctggtagcagatgacaaagtgagcacccaggaattg
ctaaggttctttcgagaatggacgtctcccggggaggcaacaagcaggtcctgctatcct
tccttcttctccttccagtgcctgggtagcggtagccggttgggccctgatcctttcaag
aacaaagatcacttccagttcaccaacctcttcttgtgcgggctgctggccaaagcccga
cagaaactccttcagcagctggtgcccaaggctatcctaaggaagaagcgcaaggccctg
tgggctcacctgtttgccagcctgcgctcctacttgaagagcctaccccgggtccagtct
gatgggtttaaccaggtacatgccatgcccacattcctgtggatgctgcgctgcatctat
gagacacagagtcagaaggtggggcgcttagccgccaggggcatcagtgcggactacctc
aagctagccttctgcaatgcttgttctgccgactgtagtgccttgtccttcgtcctgcat
cacttccacagacagctggccctagacctggacaacaacaacctcaatgactatggagtt
cgagagctgcagccttgctttagccgtctcacggttatcagactcagtgtcaaccagatc
accgacatgggggtgaaggtgctgtgtgaggaactgaccaagtacaaaatcgtgacattc
ttgggtttatacaacaaccagatcactgatatcggagccaggtatgtggcccaaatcctg
gatgaatgcagaggcctcacgcaccttaaactggggaaaaacagaataacaagtgagggc
ggcaggtgtgtggcccaggctgtgaagaacagcacctccattgttgaggttgggatgtgg
ggcaatcagattggagacgagggagcaaaagccttcgcagaggcgctgagggaccacccc
agcctgaccactcttagtcttgcattcaatggcatctccccggagggagggaagagcctt
gcacaggccctgaagcagaacaccactctgacaataatctggctgaccaaaaatgaactt
aatgatgaggccgcagagtgcttcgccgagatgctgagggtgaaccagacactgaagcat
ttatggctaatccagaatcatatcacagctgaggggacagcccagctggccagggcactg
cagaagaataccaccatcacagagatttgcctcaatggaaacttaattaagcccgaggag
gccaaagtctttgaaaatgagaagcggatcatctgtttctga

DBGET integrated database retrieval system