KEGG   Rattus norvegicus (rat): 500255Help
Entry
500255            CDS       T01003                                 

Gene name
Eefsec, RGD1560552
Definition
(RefSeq) eukaryotic elongation factor, selenocysteine-tRNA-specific
  KO
K03833  selenocysteine-specific elongation factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    500255 (Eefsec)
Translation factors [BR:rno03012]
 Eukaryotic type
  Elongation factors
   500255 (Eefsec)
 Prokaryotic type
   500255 (Eefsec)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU SRPRB MMR_HSR1 cobW Gtr1_RagA FliS_cochap GTP_EFTU_D2 RIBIOP_C RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 500255
NCBI-ProteinID: NP_001102719
RGD: 1560552
Ensembl: ENSRNOG00000012954
UniProt: D3Z9S4
Position
4q34
AA seq 363 aa AA seqDB search
MAGRRVNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFVVPL
PGAEPGTSDTLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLVIG
QIACQKLVVVLNKIDLLAEGKRQAAIDKMTKKMQKTLENTKFRGAPIIPVAAKPGGPEAP
ETEAPQGISELIELLKSQISIPTRDPSGPFLMSVDHCFSIKGQGTVMTGTILSGTISLGD
SVEIPALKVMDDYSVIGRSLFKKETNIQLFVGLKVQLSTGEQGIIDSAFGQSGKFKIHIP
GGLSPESKKILTPTLKKRSRAGRGETTKQEESTERPEPIQPVTLSLSFKRYVFDTQKRMV
QTP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccggcgggtaaatgtgaatgtgggtgtgctgggtcatatcgatagcggcaag
acagcgctggcgcgcgcgctgagcactacggcctccaccgctgccttcgacaagcagccg
cagagccgcgagcgcggcataacgctcgacctgggcttctcctgttttgtggtgccgctg
ccgggggctgaacccgggactagcgacacgctgctgcaggtcacgctggtcgactgtccc
gggcacgcctccctcatccggaccatcattggcggtgcccagatcattgatttgatgatg
ctcgtgattgatgtgaccaagggaatgcagacacagtccgcagagtgccttgtgatcggc
cagattgcctgccagaagctggttgtggtgctgaacaaaatagacctgttagcagaaggg
aagagacaggcagcgattgacaaaatgaccaagaaaatgcagaagactcttgagaacacc
aaattccggggtgcaccgattattcccgtggcagccaagcctgggggaccagaggcccct
gaaacagaagctccacagggcatctcagaactcattgagcttctgaagtcccagatttcc
atcccaacgagagacccctctggaccattccttatgtctgtggatcactgcttctccatc
aagggtcagggcaccgtgatgactgggaccatcctctcgggcactatcagcctcggggac
agtgtggagatccctgccctcaaggtaatggatgactacagcgtgattggacgttccctg
ttcaaaaaggagaccaacatccagctctttgtggggcttaaggtacagctgtccacagga
gagcagggcatcatcgacagtgccttcggccaaagcggcaagttcaagatccacatccct
ggtggcctcagccctgagtctaagaagatcctgacacctacactcaagaagcggagccga
gctggccgtggggaaaccaccaagcaagaagagagcactgagcgtccagaacccatacag
cctgtgacactcagcctgtctttcaagcgctatgtctttgacacccagaagcgcatggta
cagactccctga

DBGET integrated database retrieval system