KEGG   Rattus norvegicus (rat): 500904
Entry
500904            CDS       T01003                                 

Gene name
Ncf4
Definition
(RefSeq) neutrophil cytosol factor 4
  KO
K08012  neutrophil cytosolic factor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04670  Leukocyte transendothelial migration
rno05020  Prion disease
rno05140  Leishmaniasis
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    500904 (Ncf4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    500904 (Ncf4)
   04670 Leukocyte transendothelial migration
    500904 (Ncf4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    500904 (Ncf4)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    500904 (Ncf4)
  09164 Neurodegenerative disease
   05020 Prion disease
    500904 (Ncf4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    500904 (Ncf4)
   05415 Diabetic cardiomyopathy
    500904 (Ncf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    500904 (Ncf4)
Membrane trafficking [BR:rno04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    500904 (Ncf4)
SSDB
Motif
Pfam: PB1 PX SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 500904
NCBI-ProteinID: NP_001120776
RGD: 1593157
Ensembl: ENSRNOG00000006940
UniProt: B2RZ98
Position
7
AA seq 339 aa
MALAQQLRSESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGVKQEIAETRIPALNAYMKNLLSLP
VCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGVTPQGPSMDRMEAPRAEALFD
FTGNSKLELSFKAGDVIFLLSKINKDWLEGTTQGATGIFPGSFVKILKDFPEDEDTTNWL
RCYFYEDTGKTIKDIAVEEDLSSTPLFKDLLALMRREFQREDIALNYQDAEGDLVRLLSD
EDVGLMVKQAQGLPSQKRLFPWKLHVTQKDNYGVYNTVP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggccctggcccagcagctgcgatcagagagcgattttgagcagcttccagatgatgtg
gccatctcagccaacatcgctgacatcgaggagaagaggggcttcaccagccactttgtg
tttgtcatcgaggtaaagacaaaaggaggatccaagtatctcatctaccgccgatatcgc
cagttctacgccctgcagagcaagctggaggagcggtttggaccagagagcaagaacagc
ccattcacctgcagcctgcccacactgccagccaaagtctacatgggtgtcaaacaagag
attgctgagactcggatcccggccctcaatgcctacatgaagaacctcctgagcctgccg
gtctgcgtgctgatggaccccgacgtcagaatattcttctatcagtctgcttacgacgca
gagcaggtgcctcaggcacttcgtaggctccgaccgcgcacgcgcaaaatcaagggcgtg
actccacaagggcccagcatggaccgcatggaagctccaagagcagaggccttgtttgac
ttcactgggaacagcaaactggagctaagtttcaaagctggagatgtgatcttccttctc
agtaagatcaacaaagactggttggagggcacaacccagggagccacaggcatcttccca
gggtctttcgtgaagatcctcaaggacttccccgaagacgaggacactaccaactggctg
cgatgctacttctacgaagacacaggcaaaaccatcaaggacattgcagtggaggaggac
ctcagcagcacccccctgttcaaagacctgctagcactcatgaggcgtgaattccagaga
gaggacattgcccttaattaccaagatgctgagggggacctggttcggctgctgtcagat
gaggatgtgggactcatggtgaagcaggcccaaggcctcccctcccagaagcgcctcttc
ccctggaagctgcacgtcacccagaaggacaattacggtgtctacaacaccgtaccctga

DBGET integrated database retrieval system