KEGG   Rattus norvegicus (rat): 501283
Entry
501283            CDS       T01003                                 

Gene name
Plin5, Oxpat
Definition
(RefSeq) perilipin 5
  KO
K20255  perilipin-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    501283 (Plin5)
SSDB
Motif
Pfam: Perilipin DUF1932
Other DBs
NCBI-GeneID: 501283
NCBI-ProteinID: NP_001128109
RGD: 1589602
Ensembl: ENSRNOG00000047860
UniProt: M0R7Z9
Position
9q12
AA seq 475 aa
MDQRGKDTTLALHSRMSGDQTAQDPGSSLGELDQHNVVKRVVALPLVRATCTAVSGAYNS
AKDRHPLLGSACRFAEHCVCSVATCALDHAQPLLEHLQPKLATVNDLACRGLDKLEEKLP
FLQQPSDTVVTSAKDAVAKSVTGVVDLAQRGRRWSGELRRSVSQAMDTVLRRSVSQAMDT
VLGKSEELVDHFLPMTEAELVALATESQGPEVGSVEEQRQKQGYFVRLGSLSARLRHLAY
QHSLGKLRESKHRTQEMLAQLQKTLELIQHMQSRASPTPTFHHPKVQELCGDWSPCLENG
YRHSQVELETLALSRSLTLELQSAVDALAGCVRGLPPSAQAKVAEVQRSVDALQATFADA
HCLGDVAPTALAEGQDSVAQAHACVDEFLDLVLRAMPLAWLVGPFAPILVERSEPLINLA
TCVDEVVGDPDPRWAHMDWPAQQRAWEAEPADPGGQEAEPPLGQVKHTMMPELDF
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggaccagagaggcaaagacaccaccctagctctacacagcaggatgtccggtgatcag
acagctcaggaccctggatccagcctgggggaactggaccagcacaacgtggtgaagcga
gtggtggccttgcccctggtcagggccacgtgcactgctgtgtctggtgcctacaactca
gccaaggacaggcacccgctgctgggctctgcctgccgctttgctgaacactgtgtgtgt
agtgtggctacctgtgccctggaccacgcacagccactgctggagcacctgcagcccaag
ttggccacagtgaatgatcttgcctgcaggggactagacaaattggaagagaagctgccc
ttcctgcagcagccatcggacacggtggtcacctcagccaaggatgcagtggccaaaagt
gtcacaggcgtggtggacctggcccaaaggggccggcgttggagcggggagctgaggcgc
tccgtgagccaagccatggacactgtgctgaggcgctccgtgagccaagccatggacact
gtgctgggcaaatcagaggagctggtggaccatttcctgcccatgactgaagctgagcta
gtggccctggcgactgagtcccagggcccagaagtgggctcagtggaggagcagaggcag
aaacagggctactttgtgcgtctgggatccctatcggcacgcctccgccatcttgcctat
caacactctttggggaaactgagggagagcaaacaccgcacccaggagatgctggcccag
ctgcagaaaactctggagctgatccagcatatgcagagtagggcaagccccacccctact
ttccatcacccaaaggtccaggagctttgcggggactggagcccatgtctggagaatggc
taccgccacagccaggtggagctggagacactggctctgtcgagaagtctgaccctggag
ctgcagagtgcagtggatgcccttgcaggctgtgttcggggcctgccccctagtgcccag
gccaaggtggctgaagtgcagcgcagtgtggatgctctacaggccacctttgctgatgca
cactgccttggtgacgtggcacccactgctctggctgagggccaggacagcgtggcccag
gcacatgcctgtgtggatgagttcctggatttggtccttcgagccatgccactggcctgg
cttgtggggccctttgcgcccatcttggtggagcggtcagagcccctgatcaacctggcc
acctgtgtggatgaggtggtgggtgaccctgacccccgctgggcacacatggactggcca
gcccagcagagggcctgggaggctgagcctgcagaccctgggggacaagaggctgagccc
ccactgggccaggtcaagcacacaatgatgccagagctagacttctga

DBGET integrated database retrieval system