KEGG   Rattus norvegicus (rat): 50594Help
Entry
50594             CDS       T01003                                 

Gene name
Nbl1
Definition
(RefSeq) neuroblastoma 1, DAN family BMP antagonist
  KO
K19558  neuroblastoma suppressor of tumorigenicity 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    50594 (Nbl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAN Cys_knot
Motif
Other DBs
NCBI-GeneID: 50594
NCBI-ProteinID: NP_113797
RGD: 3151
Ensembl: ENSRNOG00000049402
UniProt: Q06880
Position
5q36
AA seq 178 aa AA seqDB search
MLWVLVGTVLPVMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLG
QCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQ
ACGKEPSHEGLNVYMQGEDGPGSQPGSHSHSHPHPGCQTPEPEEPPGAPQVEEEGAED
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgctttgggtcctggtggggactgttctccctgtcatgttgctggctgccccaccaccc
atcaacaagctggccctgtttccggacaagagtgcctggtgcgaagccaagaacatcacg
cagattgtgggccacagcggctgtgaggccaagtctatccagaacagggcgtgcctagga
caatgcttcagttacagcgtccccaacaccttcccgcagtccacagagtccctggtgcac
tgtgactcctgcatgccggcccagtccatgtgggagattgtgaccttggagtgccccggc
cacgaggaggtgcccagggtggacaagctggttgagaagattgtacactgcagctgccaa
gcctgcggcaaggaacccagtcatgagggcctgaacgtctacatgcagggtgaagatggg
ccaggctcccagccaggatcgcactcccactcccatccccaccctgggtgccagacccct
gaacctgaagaacctcctggagcccctcaagttgaggaagagggggctgaggactga

DBGET integrated database retrieval system