KEGG   Rattus norvegicus (rat): 541589
Entry
541589            CDS       T01003                                 

Gene name
Kyat3, Ccbl2, Kat3
Definition
(RefSeq) kynurenine aminotransferase 3
  KO
K00816  kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00380  Tryptophan metabolism
rno00450  Selenocompound metabolism
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    541589 (Kyat3)
   00380 Tryptophan metabolism
    541589 (Kyat3)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    541589 (Kyat3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    541589 (Kyat3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    541589 (Kyat3)
Enzymes [BR:rno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     541589 (Kyat3)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     541589 (Kyat3)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     541589 (Kyat3)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class I
   541589 (Kyat3)
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 541589
NCBI-ProteinID: NP_001015037
RGD: 1359262
UniProt: Q58FK9
Position
2q44
AA seq 454 aa
MLLAQRRLFSLGCRAKPIKTIYSSKVLGLSTSAKMALRFKNAKRIEGLDQNVWVEFTKLA
ADPSVVNLGQGFPDITLPSYVQEELSKAAFIDNLNQYTRGFGHPSLVKALSCLYGKIYQK
QIDPNEEILVTVGGYGSLFNAIQGLVDPGDEVIIMVPFYDCYEPMVKMAGAVPVFIPLRS
KRTDGMKWTSSDWTFNPQELESKFSSKTKAIILNTPHNPIGKVYTREELQVIADLCIKHD
TLCISDEVYEWLVYTGHKHIKVASLPGMWDRTLTIGSAGKTFSVTGWKLGWSIGPGHLIK
HLRTVQQTSVYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMACLLNSV
GLKPIIPDGGYFIIADVSSLGVDLSDVKSDEPYDYKFVKWMTKNKKLSAIPVSAFCDSES
KPHFEKLVRFCFIKKDSTLDAAEEIFRTWNSRKS
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcttttggcccagaggagactcttctcccttggctgcagagcaaagcccataaagaca
atttactcttcgaaagttctcggactctccacttctgccaaaatggctttgagattcaaa
aatgccaaacgaatcgaaggcctggaccaaaacgtgtgggttgaatttaccaagttggcc
gcggatccttctgtggtgaatcttggacaaggttttcctgatataacccttccttcatat
gtacaagaagaattgtcaaaggcggcatttattgataacctgaatcaatacacaaggggc
tttggtcatccatcacttgtgaaagcgctatcctgcttatacggaaagatttatcaaaag
caaattgatccaaatgaagaaattcttgtgacggtggggggatatggatcgctctttaat
gccatccaaggcttggtggacccaggagatgaagtgataattatggtgcctttttacgac
tgttatgagcccatggtgaaaatggctggagcagtgcctgtgtttattcccctgagatct
aaacgtactgacgggatgaagtggactagctctgattggacattcaatcctcaagaactg
gaaagtaaattcagttccaaaacgaaagccattatattaaatactccacataaccccatc
ggcaaggtgtataccagagaggagctgcaagtcattgctgacctttgcatcaaacatgac
actttgtgcatcagcgatgaggtttatgaatggcttgtctatactggacataagcacata
aaagtagccagcctccctggcatgtgggatcggaccctgaccatcggcagtgcaggcaag
acattcagtgtgaccggctggaagctcggctggagcattggccctggtcacctgataaaa
catttgcggactgttcagcaaaccagtgtatacacgtgtgcaactcctttacaggcagcc
ttggccgaggctttttggatcgatatcaagcgcatggatgacccagagtgttacttcaat
tctctgccaaaggaattagaagttaagagagatcggatggcctgtttacttaacagcgtt
ggcctgaaacccatcatccctgacgggggctacttcatcattgccgatgtgtcttcatta
ggtgttgacctctcggatgtgaagagcgatgagccttatgactataagtttgtgaagtgg
atgacgaaaaataagaaattgtcagccattcctgtatccgcgttctgcgactccgagtct
aaacctcactttgagaagttggtgcggttttgctttatcaaaaaagacagcactctggat
gctgcggaagaaatcttcaggacgtggaacagccggaagtcttga

DBGET integrated database retrieval system