KEGG   Rattus norvegicus (rat): 54245
Entry
54245             CDS       T01003                                 

Gene name
Crk, CrkII, Crko
Definition
(RefSeq) CRK proto-oncogene, adaptor protein
  KO
K04438  proto-oncogene C-crk
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04510  Focal adhesion
rno04666  Fc gamma R-mediated phagocytosis
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    54245 (Crk)
   04010 MAPK signaling pathway
    54245 (Crk)
   04012 ErbB signaling pathway
    54245 (Crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    54245 (Crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54245 (Crk)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    54245 (Crk)
   04062 Chemokine signaling pathway
    54245 (Crk)
  09152 Endocrine system
   04910 Insulin signaling pathway
    54245 (Crk)
   04935 Growth hormone synthesis, secretion and action
    54245 (Crk)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    54245 (Crk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54245 (Crk)
   05206 MicroRNAs in cancer
    54245 (Crk)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    54245 (Crk)
   05211 Renal cell carcinoma
    54245 (Crk)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    54245 (Crk)
   05100 Bacterial invasion of epithelial cells
    54245 (Crk)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    54245 (Crk)
   05163 Human cytomegalovirus infection
    54245 (Crk)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 54245
NCBI-ProteinID: NP_062175
RGD: 2405
Ensembl: ENSRNOG00000025792
UniProt: Q63768
Position
10q24
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPE
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcaggcaacttcgactcggaggagcggagtagctggtactggggccgcttgagccgg
caggaggcggtggcgctattgcagggccagcggcacggggttttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgaaaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgccctccagtgcctccgtcgcccgctcagcctccgccg
ggagtgagtccctccaggctccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacactgatagaaccagtttccaga
tcaaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgggccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggaaagaggggg
atgattcctgtcccttacgtggagaagtatagacccgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggttatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgag
gaggacttcagctga

DBGET integrated database retrieval system