KEGG   Rattus norvegicus (rat): 54249
Entry
54249             CDS       T01003                                 

Gene name
Cfd
Definition
(RefSeq) complement factor D precursor
  KO
K01334  complement factor D [EC:3.4.21.46]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    54249 (Cfd)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    54249 (Cfd)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    54249 (Cfd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    54249 (Cfd)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.46  complement factor D
     54249 (Cfd)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   54249 (Cfd)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 54249
NCBI-ProteinID: NP_001071110
RGD: 2498
Ensembl: ENSRNOG00000033564
UniProt: P32038
Position
7
AA seq 263 aa
MHSSVYLVALVVLEAAVCVAQPRGRILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQW
VLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFK
LSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTC
NLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFT
RVATYVPWIENVLSGNVSVNVTA
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcacagctccgtgtacctcgtggctctggtggtcctggaggcggctgtatgtgttgcg
cagccccgaggtcggattctgggtggccaggaggccatggcccatgctcggccctacatg
gcttcagtgcaagtgaatggcacgcacgtgtgcggtggcaccctggtggatgagcagtgg
gtgctgagcgccgcgcactgcatggatggagtgaccaaggatgaggttgtgcaggtgctc
ctgggtgcccactccctgtccagtcctgaaccctacaagcatttgtatgatgtgcaaagt
gtagtgcttcacccgggcagccggcctgacagcgttgaggacgacctcatgctctttaag
ctctcccacaatgcctcactgggtccccatgtgagacccctgcccttgcaacgcgaggac
cgggaggtgaaacccggcacgctctgcgatgtggccggttggggcgtggtcactcatgcg
ggacgcaggcccgatgtcctgcagcaactgacagtgtcaatcatggaccggaacacctgc
aatctgcgcacgtaccatgatggggcaatcaccaagaacatgatgtgtgcagagagcaac
cgcagggacacttgcaggggcgactccggcggtcctctggtgtgcggggatgcggtcgaa
gctgtggttacgtggggatctcgagtctgtggcaaccggagaaagccaggtgtctttacc
cgcgtggcaacctacgtgccgtggattgaaaacgttctgagtggtaacgtgagtgttaac
gtgacggcctga

DBGET integrated database retrieval system