KEGG   Rattus norvegicus (rat): 54261Help
Entry
54261             CDS       T01003                                 

Gene name
Kcnn1, KCa2.1
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 1
  KO
K04942  potassium intermediate/small conductance calcium-activated channel subfamily N member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    54261 (Kcnn1)
   04929 GnRH secretion
    54261 (Kcnn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    54261 (Kcnn1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   54261 (Kcnn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SK_channel CaMBD Ion_trans_2 DALR_1 Ion_trans Laminin_II Seryl_tRNA_N DUF4140
Motif
Other DBs
NCBI-GeneID: 54261
NCBI-ProteinID: NP_062186
RGD: 2962
Ensembl: ENSRNOG00000029264
UniProt: P70606
Position
16p14
AA seq 536 aa AA seqDB search
MSSRSHNGSVGRPLGSGPGFLGWEPVDPEAGRPRQPTQGPGLQMMAKGQPAGLSPSGPRG
HSQAQEEEEEEEDEDRPGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTE
TELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWE
RVSLISLELAVCAIHPVPGHYRFTWTARLAFSLVPSAAEADVDVLLSIPMFLRLYLLARV
MLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSISSWIVAAWTVRVC
ERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAV
VARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQSRVRKHQ
RKFLQAIHQAQKLRTVKIEQGKVNDQANTLADLAKAQSIAYEVVSELQAQQEELEARLAA
LESRLDVLGASLQALPSLIAQAICPLPPPWPGPSHLTTAAQSPQSHWLPTTASDCG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccgcagccacaatggcagtgtggggcggcctctgggcagtgggcctggattc
ctgggctgggaacctgtggaccccgaggcaggccgcccccgacagcccacccaaggcccc
ggcctgcagatgatggccaagggtcagcctgctgggctgtcacccagtggccccaggggc
cactcccaggcgcaggaggaggaagaggaagaggaagacgaggacaggccaggctcaggg
aagcccccgaccgtcagtcaccgcctgggccaccgtagggccctcttcgagaagcgtaaa
cgactcagtgactatgcactcatctttggcatgttcgggattgtcgtcatggtgacagaa
acagagctgtcctggggtgtgtacaccaaggagtctctgtgctcattcgccctgaaatgc
ctaatcagcctctccactgtcatcctgcttggccttgtcatcctctaccacgcccgagag
atccagctgttcctggtggacaatggtgccgatgactggcgcattgccatgacgtgggag
cgagtgtccctgatctcgctggagttggctgtgtgtgccatccacccagtgcctggccac
taccgcttcacatggacggcgcggctggccttctccctggtgccgtcagcagccgaggcg
gatgtggatgtgcttctgtccatccccatgtttctgcgcctctatctgctggctcgggtc
atgctcctgcacagccgcatcttcacggacgcatccagtcgcagcatcggagccctgaac
cgtgtcaccttcaacacacgctttgtcaccaagacactcatgaccatctgccctggcacc
gtgctgttggtcttcagcatctcctcctggatcgtcgctgcatggacagtgcgcgtgtgt
gagaggtaccatgataaacaggaagtgaccagcaacttcctgggggccatgtggctcatc
tccattaccttcctgtccatcggctacggggacatggtgccgcacacctactgtgggaag
ggcgtgtgtctgctcaccggcatcatgggagcaggctgcactgcactcgtggtggccgtc
gtggcccggaagttggaactcaccaaggctgagaaacacgtgcacaacttcatgatggac
acacagctcaccaagcgggttaaaaacgccgctgcaaacgttctcagggagacatggctc
atctacaaacacaccaggctagtgaagaagccagaccaaagccgggttcggaaacaccag
cgtaagttccttcaggccatccatcaggcgcagaagctccggactgtgaagattgaacaa
gggaaggtgaatgatcaggccaacacgctggctgacctggccaaggcacagagcatcgca
tatgaggtggtgtcggagctgcaggcccagcaggaggagttggaggcccgtctggctgcc
ctggagagccgcctggatgtcctaggcgcctccctgcaggccctaccaagtctcatagcc
caagccatatgccctctaccaccaccctggcccgggcccagtcacctgaccacagccgcc
cagagcccacaaagccactggctgcccaccacggcatcagactgtgggtga

DBGET integrated database retrieval system