KEGG   Rattus norvegicus (rat): 56227
Entry
56227             CDS       T01003                                 

Gene name
Espn, Je
Definition
(RefSeq) espin
  KO
K24047  espin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    56227 (Espn)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EVH1 / WASP  homology  (WH) domain-containing proteins
  WH2 domain-containing proteins
   56227 (Espn)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 WH2 DUF1843 Tir_receptor_N
Other DBs
NCBI-GeneID: 56227
NCBI-ProteinID: NP_062568
RGD: 620652
Ensembl: ENSRNOG00000010270
UniProt: F1LQ34
Position
5q36
AA seq 838 aa
MALEQAMQAARRGDLDVLRSLHAAGLLGPSLRDPLDALPVHHAARSGKLHCLRYLVEEVA
LPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVV
NWLLYQGGANSAITTDTGALPIHYAAAKGDLPSMKLLVGHYPEGVNAQTNNGATPLYLAC
QEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDG
ATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTPLHDAAENGELECCQILAVNGAGLDV
RDHDGYTAADLADFNGHTHCSRYLRTVQTLSLEHRVLSRDPSMDLEAKQPDSGMSSPNTT
MSVQPPNFDLGSPTSTLSNYDSCSSSHSSSKGQRSTRGARSSDLQSYMDMLNPEPRSKQG
KPSSLPPPPPPSFPPPPPPGTQLPPPPPGYPAPNPPVGLHLDNIYMQTKNKLRHVEVDSL
KKEPSSGDGYSGLRRQDSGLLRQDSELLLRHNTGLRRQDSDRKQRSFSKQPSTGDYYRQL
GRSPGEPLAARPGMAHSEEAALLPGNHVHNGCSADSKASRELPPPPPPPPLPEALSSPPP
APPLPIEGAGAACGQRRSSSSTGSTKSFNMMSPTGDNSELLAEIKAGKSLKPTPQSKGLT
TVFSGSGQPASQPESPQPAVSPGPSRARSPTPPASGPQPLLNGSIVPAPPATLAPGVHLD
VEALIPTLDEQGRPIPEWKRQVMVRKLQQKMQEEEEQRRKEEEEEARLASLPAWRRDILR
KKLEEEREQKRKEEERQKLEEIQRAKEQSEKLRTLGYDEAKLAPWQRQVILKKGEIPK
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggccctggaacaggcgatgcaggcggcacggcggggcgacctggacgtgctgaggtcc
ctgcacgccgccggcctgctggggccttctctgcgcgacccgctagacgccctgccggtg
caccatgcggcccgctcaggcaagctgcactgtttgcgctacttggtggaggaggttgcc
ctcccagctgtgtcccgcgcgcgcaacggcgccacaccagcccatgatgccgctgccacg
ggctacctctcttgcctgcagtggctgctcacacagggtggctgcagggtgcaggaaaaa
gataactctggtgccacggtcctgcacctggctgcccgctttggccacccggacgtggtg
aactggctgctgtaccagggcggtgcgaactctgccatcaccacagacacgggcgccctg
cctatccactatgctgccgccaaaggagatctcccctccatgaagcttcttgtcgggcac
taccctgagggagtgaatgcccaaaccaacaacggtgccacgcccctgtacctggcgtgc
caggagggccacctggaagtgacgaagtaccttgtgcaggagtgcagtgcagatccgcac
ctgcgcgcccaagacggcatgacccccctgcatgccgcggcgcagatgggccacaaccca
gtcctggtgtggctggtgagctttgcggacgtgagcttttcggagcaggaccacgacggc
gccacagccatgcactttgcagccagccgcggccacaccaaagtgctcagctggctcctg
ctgcacggcgcagagatctcccaggacctgtggggcgggaccccgctgcatgatgctgct
gagaacggggaactggagtgctgccagatcctcgcggtgaatggtgcggggctggacgtc
cgcgaccacgatgggtatacggctgcggacctggctgatttcaatggccacacccactgc
tcccgctacctacgtacggtgcaaaccctgagcttggaacaccgagtcctgtcccgggat
ccatccatggacctggaggcaaagcagccggactcaggcatgtcttcacccaacaccacc
atgtcggtccagccgccgaactttgaccttggctcacccaccagcaccctctccaactat
gactcctgctcctccagccattccagcagcaagggtcagcgctctactcgaggtgccaga
tcctcagacttacagagctacatggacatgctgaacccagagcctcggagcaagcaaggg
aagccttcatctctaccaccaccgccaccaccaagcttccctccaccaccacccccaggc
acacagctgcccccacctccaccaggctacccagctcccaatccccctgtggggctgcat
ttggataacatttacatgcagaccaagaacaaactccgccacgtggaggtggactccctc
aagaaggagccgagctccggcgacggctactcggggctacgcaggcaggattccgggctg
ctcaggcaggattcggagctgctgctcaggcacaacaccggactgcgcaggcaggactcc
gaccgcaaacagcgttcattcagtaaacagcccagcacgggggactactaccgccagctg
ggccgcagcccgggggagccgctggccgcacgcccgggcatggcccacagcgaggaggcg
gcgctgctccccgggaaccacgtgcacaacggctgctccgcggactccaaagcgtccagg
gagctgccgccgccaccgccgccgccgcccctgcccgaggccctgagttcgccgccaccc
gccccacctctgcccatcgagggcgcgggcgcagcctgcggacagcggcgttcctcatct
tctactggcagcaccaaatctttcaacatgatgtccccaacgggtgacaactcggagttg
ctggctgaaataaaagcaggcaagagtctgaaaccaacaccgcagagcaaggggctgaca
acagtgttctcaggcagcgggcagccagcctcccagcctgagtcaccacagcctgcggtg
tcacctgggccatctcgggcccggagccccaccccaccagcctctgggcctcagccactg
ctcaatggcagcatagtaccggcaccacctgccaccctagcaccaggagtgcatctggat
gtggaggccctcatccccacacttgatgagcagggccggcccatcccggagtggaagcgc
caggtgatggtccggaagctgcagcagaaaatgcaggaggaagaggagcagcggaggaag
gaagaagaggaggaggcccggctggccagcctgcccgcctggagacgagacattcttagg
aagaagctggaggaggagagggagcagaagcgaaaagaggaggagcggcagaagctggag
gaaatccagagggcgaaagaacagtcggagaagctgcggacactaggatacgacgaggcc
aagctcgcgccctggcagcgacaggtcatcttgaagaagggggagatccctaagtaa

DBGET integrated database retrieval system