KEGG   Rattus norvegicus (rat): 56816Help
Entry
56816             CDS       T01003                                 

Gene name
Park2, Park, Prkn
Definition
(RefSeq) parkin RBR E3 ubiquitin protein ligase
  KO
K04556  parkin [EC:2.3.2.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04137  Mitophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56816 (Park2)
   04120 Ubiquitin mediated proteolysis
    56816 (Park2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    56816 (Park2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    56816 (Park2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    56816 (Park2)
   04121 Ubiquitin system [BR:rno04121]
    56816 (Park2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    56816 (Park2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     56816 (Park2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    56816 (Park2)
  Aggrephagy
   Other aggrephagy associated proteins
    56816 (Park2)
  Xenophagy
   Other xenophagy associated proteins
    56816 (Park2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    56816 (Park2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    56816 (Park2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_14 zf-RING_12 ubiquitin IBR Rad60-SLD Rad60-SLD_2 DUF2407 Blt1
Motif
Other DBs
NCBI-GeneID: 56816
NCBI-ProteinID: NP_064478
RGD: 61797
UniProt: Q9JK66
Structure
PDB: 

Position
1q11
AA seq 465 aa AA seqDB search
MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCD
LEQQSIVHIVQRPQRKSHETNASGGDKPQSTPEGSIWEPRSLTRVDLSSHILPADSVGLA
VILDTDSKSDSEAARGPAAKPTYHSFFVYCKGPCHKVQPGKLRVQCGTCRQATLTLAQGP
SCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITNNSRSIPCIA
CTDVRNPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGC
GFVFCRDCKEAYHEGECDSMFEASGATSQAYRVDQRAAEQARWEEASKETIKKTTKPCPR
CNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgtttgtcaggttcaactccagctatggcttcccagtggaggtcgattctgac
accagcatcttccagctcaaggaagtggttgctaagcgacagggggttccagctgaccag
ctgcgagtgatttttgctgggaaggagctgcagaatcacctgacagtacagaactgtgac
ctggaacaacagagtatcgttcacatagtacagagaccacagaggaaaagtcacgaaaca
aatgcctctggaggggacaaaccccagagcaccccggagggctccatatgggagcccaga
agcttgactcgagtggacctcagcagccatatcctgccagcggactccgtggggctggca
gtcattctggacacagacagcaagagtgactcagaagcagccagaggtccagcagctaaa
cccacctaccacagcttttttgtctactgcaaaggcccctgccacaaggtccagcctggg
aaactccgagttcagtgcggcacctgcagacaagcaaccctcaccttggcccagggccca
tcttgctgggatgatgtcttaattccaaaccggatgagtggagagtgccaatctccagac
tgccctgggacaagagctgaatttttctttaaatgtggagcacacccaacctcagacaag
gacacatcagtagctttgaacctgatcaccaacaacagccgcagcatcccctgcatcgcg
tgcacggatgtcaggaaccctgtcttggtcttccaatgtaaccaccgccacgtgatctgt
ttggactgcttccacttgtactgtgtcacaaggctcaacgatcggcagtttgtccacgac
gctcaacttggctactccctgccgtgtgtggctggctgtcccaactccctgattaaagag
ctccatcacttcaggatccttggagaagagcagtacaacaggtaccagcagtatggtgcc
gaggagtgcgtgctgcagatgggaggtgtgctgtgcccccgtcctggctgcggagctggg
ctgctgcctgaacagggccagaggaaagtcacctgcgaagggggcaacggcctgggctgt
gggttcgttttctgccgggactgcaaggaagcataccatgaaggggagtgcgactcgatg
ttcgaagcctcgggggcgacttctcaggcataccgggtggatcaaagagctgctgagcaa
gcacggtgggaggaggcctccaaggaaaccatcaagaaaaccaccaagccttgtcctcgc
tgcaatgtgcccattgaaaagaatggaggatgtatgcacatgaagtgtcctcagccccag
tgcaagctggagtggtgctggaactgtggctgtgagtggaaccgagcctgcatgggtgat
cactggtttgacgtgtag

DBGET integrated database retrieval system