KEGG   Rattus norvegicus (rat): 574531
Entry
574531            CDS       T01003                                 

Gene name
Lair1
Definition
(RefSeq) leukocyte-associated immunoglobulin-like receptor 1
  KO
K06725  leukocyte-associated Ig-like receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    574531 (Lair1)
CD molecules [BR:rno04090]
 Proteins
  574531 (Lair1)
SSDB
Motif
Pfam: Ig_2 Cadherin_C_2 ig TMEM52 Flavi_NS2B TSP_NTD SID-1_RNA_chan Ig_3 WBP-1 Comm
Other DBs
NCBI-GeneID: 574531
NCBI-ProteinID: NP_001025099
RGD: 1560048
Ensembl: ENSRNOG00000027733
UniProt: P0C1X9
Position
1q21
AA seq 263 aa
MPLHSVIVLVLVLCLGWKSNTQEESLSDFTICAEPGPVIPQGNFITIVCSTSGEYDTVRL
EKEGSTFMEKKTEPHGKQHRFRIGPVNETITGYYNCIFEKNYVWSQRSNDLQLKVIKENV
TQGLAPGPSMTSDTSWLKTYSIHILTVVSVIFLLCLSLFLFCFLSHRQKKQGLPNNKSQH
QRSQERLNLATNGLEKTSDIVMDDSLSEDRQTETWTPVAGDLQEVTYAQLDHDSLTQRTV
KDVTPQNRVIMAESSTYAAIMRC
NT seq 792 nt   +upstreamnt  +downstreamnt
atgccacttcattctgtcatcgtgctggtgcttgtactgtgcctgggatggaaaagtaac
acacaggaggaatctctgtccgatttcactatctgcgctgagccaggtcctgtgattcct
caagggaatttcataaccattgtgtgctcaacctctggtgaatatgacacggtccgcctg
gagaaggaaggcagcacctttatggaaaagaaaacagagcctcatggaaaacagcataga
ttccgtattgggccagtgaatgaaaccattactggatattataactgtatctttgaaaaa
aattatgtatggtctcaacgaagtaatgatctgcagctaaaagtgatcaaagaaaatgtc
acccagggtcttgccccaggtccatcaatgacctcagatacatcttggctgaagacgtac
agcattcacattcttactgtggtctctgtgattttcctcctttgtctttccctctttcta
ttctgctttcttagccaccgtcagaaaaagcagggacttccaaacaataagagccagcat
cagaggtcacaggagaggctcaacctagctactaatggcctggagaagacatcagacata
gtcatggatgacagcctttctgaggacagacagacagaaacttggaccccagttgcagga
gatcttcaggaggtgacatatgcccagctggaccatgactccctcacacaaaggactgtt
aaagatgtgaccccacagaacagagttatcatggctgagtccagtacatatgcagccatc
atgagatgctga

DBGET integrated database retrieval system