KEGG   Rattus norvegicus (rat): 58812
Entry
58812             CDS       T01003                                 

Gene name
Apln, Apel
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    58812 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    58812 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 58812
NCBI-ProteinID: NP_113800
RGD: 620672
Ensembl: ENSRNOG00000003984
UniProt: Q9R0R3
Position
Xq36
AA seq 77 aa
MNLSFCVQALLLLWLSLTAVCGVPLMLPPDGKGLEEGNMRYLVKPRTSRTGPGAWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgagtttctgcgtgcaggcgctgctgctgctctggctctccttgactgccgtg
tgtggagtgccactgatgctgcctccagatgggaaagggctagaagaaggcaacatgcgc
tacctggtgaagcccagaacttcgaggactggaccaggggcctggcagggaggcaggagg
aaatttcgcagacagcggccccgtctctcccataagggacccatgcctttctaa

DBGET integrated database retrieval system