KEGG   Rattus norvegicus (rat): 58820
Entry
58820             CDS       T01003                                 

Gene name
Zfp148, Zbp-89, Znf148
Definition
(RefSeq) zinc finger protein 148
  KO
K24370  zinc finger protein 148
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    58820 (Zfp148)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    58820 (Zfp148)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DNA_RNApol_7kD
Other DBs
NCBI-GeneID: 58820
NCBI-ProteinID: NP_113803
RGD: 62063
Ensembl: ENSRNOG00000001789
UniProt: Q62806
Position
11q22
AA seq 794 aa
MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDRSLPHQEILAA
DEVLQESEMRQQDMISHDELMVHEETVKNDEEQTDTHERLPQGLQYALNVPISVKQEITF
TDVSEQLMRDKKQVREPVDLQKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAF
RTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKY
HMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKGGLLTSEED
SGFSTSPKDNSLPKKKRQKPEKKSSGMDKESVLDKSDTKKDRNDYLPLYSSSTKVKDEYM
VAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQSQTISPLSTYEDS
KVSKYAFELVDKQALLDSEGSADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAA
SNNSREYALNVGTIASQPSVTQAAVASVIDENTTASILDSQALNVEIKSNHDKNVIPDEV
LQTLLDHYSHKANGQHEISFSVADTEVTSSISINSSDVPEVTQSENVGSSSQASSSDKAN
MLQEYSKFLQQALDRTSQNDAYLNSPSLNFVTDNQTLPNPPAFSSIDKQVYAAMPINSFR
SGMNSPLRTTPDKSHFGLIVGDSQHPFPFSGDETNHASATSTADFLDQVTSQKKAEAQPV
HQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAG
MTSSPDATTGQTFG
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgaacattgacgacaaactggaaggattgtttcttaaatgtggcggcatagacgaaatg
cagtcttccagggcaatggttgtaatgggtggagtgtctggccagtccgccgtgtccgga
gaacttcaggagtcagtacttcaagatcgaagtttgcctcaccaggagatccttgctgct
gacgaagtgttacaagagagtgaaatgagacaacaggatatgatatcccatgatgaactc
atggtccacgaggagacagtgaaaaatgacgaagagcagacggacacccacgagcggctt
cctcaaggactgcagtatgcgcttaatgtccccataagtgtaaagcaggagattactttt
actgatgtatctgagcaactgatgagagacaaaaaacaagtgagagagccagtagactta
cagaaaaagaagaagcggaaacaacgctctcctgcaaaaatccttacaataaatgaggat
ggatcacttggtttgaaaacccctaaatctcacgtctgtgagcactgcaacgctgccttt
agaacgaactatcacttacagagacatgtcttcatccatacaggcgaaaaaccgtttcaa
tgtagtcagtgtgacatgcgtttcatacagaagtacctgctccagagacacgagaagatc
catactggtgaaaaaccatttcgctgcgatgagtgtggaatgagattcatacagaaatat
cacatggaaaggcacaaaagaactcacagtggggagaagccttaccagtgtgaatactgc
ttacagtatttttccagaacagatcgtgtattgaaacataaacgtatgtgccatgaaaat
cacgacaaaaaactaaacagatgtgccatcaaaggtggccttctgacatcagaggaagat
tctggcttttctacgtcaccaaaagataattcactgccaaaaaagaaaaggcaaaaacct
gagaagaaatcgtccgggatggacaaggagagtgtcctggacaaatctgacacgaagaaa
gacagaaacgattacctgcccctctactcgtccagcactaaagtgaaggacgagtacatg
gtggcggagtacgctgttgaaatgccccattcctcagtgggagggtcccatttagaagac
gcttctggagagatacacccacccaagttggttctcaaaaaaatcaatagtaagagaagt
ctgaaacagcccctggagcaaagtcaaaccatttcacccctatccacttacgaagacagc
aaagtttccaagtatgcatttgagcttgtggataagcaggcattactagactcggaaggc
agtgctgacatcgatcaagtggataacttgcaggaggggcccagcaaacccgtgcacagc
agtactaattacgacgacgccatgcagttcctgaagaagaagcggtatctccaggctgca
agtaacaacagcagggagtacgcactgaatgtgggcaccatagcttctcagccttctgtg
acacaagcagccgtggccagcgtcattgatgaaaacaccacagcatccatactagattcc
caggcactgaatgtggagattaagagcaatcatgacaaaaatgttattccagatgaggtc
ctgcagactctgctggatcattattcccacaaagctaatggacagcatgagatttccttc
agcgttgcagataccgaagtgacttctagcatatcaatcaattcttccgatgtacccgag
gtcacccagtcagagaatgttggatcaagctcccaagcatcctcctcagataaagctaac
atgttgcaggagtactccaagtttctgcagcaggctttggacagaactagccaaaacgat
gcctatttgaacagcccgagccttaactttgtgactgacaaccagacccttccaaatccg
ccagcattctcttccatagacaagcaagtctatgcggccatgcccatcaatagctttcga
tcaggaatgaattctccactaagaacaactccagataagtcccactttggactaatagtc
ggtgactcacagcacccatttcccttttcaggtgacgagacaaaccacgcctctgccacg
tcaacagcagactttttggatcaagtaacttctcagaagaaagctgaggcacagcctgtc
caccaggcttaccaaatgagctcctttgaacagcccttccgtgctccataccatggatcc
agagctggaatagcaactcaatttagcactgccaatggacaggtgaaccttcggggacca
gggacaagtgctgaattttcagaattccccttggtgaatgtaaatgataatagagctggg
atgacatcttcaccagatgccacaactggccagacttttggctaa

DBGET integrated database retrieval system